DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-lambda and CG15312

DIOPT Version :10

Sequence 1:NP_001334747.1 Gene:DIP-lambda / 26067049 FlyBaseID:FBgn0267428 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_001245603.1 Gene:CG15312 / 31940 FlyBaseID:FBgn0030174 Length:464 Species:Drosophila melanogaster


Alignment Length:216 Identity:49/216 - (22%)
Similarity:75/216 - (34%) Gaps:77/216 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 EGGSISLMCSVTGVPRPKVLWRREAG-KEIILRTDGRDKTGFKSVEGERLVLTNVQRSDMGGYNC 232
            :||::|:.|...|    .::|.:|.| ...|::|            |..|||.||..:|.|.|.|
  Fly    39 KGGNVSIPCIAQG----NIMWVKEHGNNSTIVQT------------GRVLVLRNVSTTDAGIYVC 87

  Fly   233 IASNGIP-PSVSKRFNVYVNFSP-----------------TVKAIS----QLVGAPVEREV---- 271
            .||  :| ||.:.   .....||                 ..:::|    ||..|.:|.||    
  Fly    88 FAS--VPRPSTTA---TSATTSPQNLQDKETRPLEDEDDGQGESVSPKDDQLKEAEMEEEVEYLA 147

  Fly   272 --TLECIVEVFPKPLNGWYRSEGNIKLHNGNKYNISEEVINIYTWHLNLTIRHLTKSDFGTYSCS 334
              ..:.||...|.|::..|..              :..::....|..|       |:..|.|...
  Fly   148 HQRTKLIVRTVPGPVSQLYFK--------------ASTILGFLIWRFN-------KTQSGGYPVR 191

  Fly   335 SVNALGKSESLIRLQELRLPP 355
            |..|..::.|      .:.||
  Fly   192 SFTAEYRNVS------YKTPP 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-lambdaNP_001334747.1 IG_like 57..150 CDD:214653
Ig strand B 67..71 CDD:409353
Ig strand E 115..119 CDD:409353
Ig strand F 129..134 CDD:409353
Ig 153..250 CDD:472250 25/82 (30%)
Ig strand B 173..177 CDD:409353 1/3 (33%)
Ig strand C 186..190 CDD:409353 0/3 (0%)
Ig strand E 204..219 CDD:409353 2/14 (14%)
Ig strand F 229..234 CDD:409353 2/4 (50%)
Ig strand G 243..246 CDD:409353 0/2 (0%)
IG_like 271..349 CDD:214653 14/83 (17%)
Ig strand B 271..275 CDD:409353 1/9 (11%)
Ig strand C 284..288 CDD:409353 0/3 (0%)
Ig strand E 308..320 CDD:409353 2/11 (18%)
Ig strand F 330..335 CDD:409353 1/4 (25%)
CG15312NP_001245603.1 Ig 39..90 CDD:472250 20/66 (30%)
Ig strand B 43..47 CDD:409358 1/3 (33%)
Ig strand C 52..56 CDD:409358 0/3 (0%)
Ig strand F 84..89 CDD:409358 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.