DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-lambda and Nrg

DIOPT Version :9

Sequence 1:NP_001334747.1 Gene:DIP-lambda / 26067049 FlyBaseID:FBgn0267428 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_001245581.1 Gene:Nrg / 31792 FlyBaseID:FBgn0264975 Length:1309 Species:Drosophila melanogaster


Alignment Length:487 Identity:105/487 - (21%)
Similarity:178/487 - (36%) Gaps:101/487 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 GRDISFTCVVDNLGHYRVAWIKSDSKAILGIHTHMVSLNPRLSVTHNGHNTWKLHISRVQINDSG 128
            |:.:...|:.......:..|.|...:         :..:.|::..|.|.:   |.|.:...:|:|
  Fly   261 GKRMELFCIYGGTPLPQTVWSKDGQR---------IQWSDRITQGHYGKS---LVIRQTNFDDAG 313

  Fly   129 SYMCQVNTDPMKSLSGYLDVVVPPDILNHPEHNPEDGVCQEGGSISLMCSVTGVPRPKVLWRREA 193
            :|.|.|:.....:.|  ..:::..:.:.:....||.....|...:...|...|||.||:.|... 
  Fly   314 TYTCDVSNGVGNAQS--FSIILNVNSVPYFTKEPEIATAAEDEEVVFECRAAGVPEPKISWIHN- 375

  Fly   194 GKEIILRTDGRDKTGFKSVEGERLVLTNVQRSDMGGYNCIASNGIPPSVSKRFNVYVNFS---PT 255
            ||.|...|....:|    |....:.:.|:.:.|.|.|.|.|:|.: ..|.|  :||:|..   ||
  Fly   376 GKPIEQSTPNPRRT----VTDNTIRIINLVKGDTGNYGCNATNSL-GYVYK--DVYLNVQAEPPT 433

  Fly   256 VKAISQLVGAPVEREVTLECIVEVFPKPLNGWYRSEGNIKLHNGNKYNISEEVINIYTWHLNLTI 320
            :......|.....|.||::|.|...||||..|.|:...:   .|.:||:..        :.:|.|
  Fly   434 ISEAPAAVSTVDGRNVTIKCRVNGSPKPLVKWLRASNWL---TGGRYNVQA--------NGDLEI 487

  Fly   321 RHLTKSDFGTYSCSSVNALGKSE---SLIRLQELRLPPKLTTTPTPHMQTTGKSRRKHPASHKKG 382
            :.:|.||.|.|:|.:.|..|:.:   ||:..:..|    :|..|..:....|:|           
  Fly   488 QDVTFSDAGKYTCYAQNKFGEIQADGSLVVKEHTR----ITQEPQNYEVAAGQS----------- 537

  Fly   383 LNEVLRFQETHFANQIQQENEDHNEGFDL-----LKFTNSENSNIV------LESGHINSMI-NK 435
              ...|..|.| .:.::.|.:...:|..:     .:|..:.::::.      |:||....:. .:
  Fly   538 --ATFRCNEAH-DDTLEIEIDWWKDGQSIDFEAQPRFVKTNDNSLTIAKTMELDSGEYTCVARTR 599

  Fly   436 EDVNIYHPKQYGQEKTNKPSGT-----IPSTRTPWILTNAGSQRPALTSYATVALITSFWLFFWR 495
            .|..........|:..|.|..|     .......|  ...|..|..:..| |:...||       
  Fly   600 LDEATARANLIVQDVPNAPKLTGITCQADKAEIHW--EQQGDNRSPILHY-TIQFNTS------- 654

  Fly   496 VFHSLDWDAIRVSSVVHHVVVFKRRSYFEAPN 527
             |....|||                :|.:.||
  Fly   655 -FTPASWDA----------------AYEKVPN 669

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-lambdaNP_001334747.1 None
NrgNP_001245581.1 Ig 55..128 CDD:299845
IG_like 57..127 CDD:214653
Ig 135..214 CDD:299845
IG_like 141..216 CDD:214653
ig 251..332 CDD:278476 15/84 (18%)
I-set 339..427 CDD:254352 27/95 (28%)
Ig 354..427 CDD:299845 24/80 (30%)
I-set 432..517 CDD:254352 29/95 (31%)
Ig 446..517 CDD:299845 26/81 (32%)
I-set 522..611 CDD:254352 15/106 (14%)
ig 525..609 CDD:278476 13/97 (13%)
FN3 613..707 CDD:238020 17/84 (20%)
FN3 716..807 CDD:238020
fn3 817..905 CDD:278470
FN3 917..1004 CDD:238020
FN3 1041..1111 CDD:238020
Bravo_FIGEY 1155..>1221 CDD:290593
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12231
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.