DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-lambda and Nrg

DIOPT Version :10

Sequence 1:NP_001334747.1 Gene:DIP-lambda / 26067049 FlyBaseID:FBgn0267428 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_001245581.1 Gene:Nrg / 31792 FlyBaseID:FBgn0264975 Length:1309 Species:Drosophila melanogaster


Alignment Length:487 Identity:105/487 - (21%)
Similarity:178/487 - (36%) Gaps:101/487 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 GRDISFTCVVDNLGHYRVAWIKSDSKAILGIHTHMVSLNPRLSVTHNGHNTWKLHISRVQINDSG 128
            |:.:...|:.......:..|.|...:         :..:.|::..|.|.:   |.|.:...:|:|
  Fly   261 GKRMELFCIYGGTPLPQTVWSKDGQR---------IQWSDRITQGHYGKS---LVIRQTNFDDAG 313

  Fly   129 SYMCQVNTDPMKSLSGYLDVVVPPDILNHPEHNPEDGVCQEGGSISLMCSVTGVPRPKVLWRREA 193
            :|.|.|:.....:.|  ..:::..:.:.:....||.....|...:...|...|||.||:.|... 
  Fly   314 TYTCDVSNGVGNAQS--FSII
LNVNSVPYFTKEPEIATAAEDEEVVFECRAAGVPEPKISWIHN- 375

  Fly   194 GKEIILRTDGRDKTGFKSVEGERLVLTNVQRSDMGGYNCIASNGIPPSVSKRFNVYVNFS---PT 255
            ||.|...|....:|    |....:.:.|:.:.|.|.|.|.|:|.: ..|.|  :||:|..   ||
  Fly   376 GKPIEQSTPNPRRT----VTDNTIRIINLVKGDTGNYGCNATNSL-GYVYK--DVYLNVQAEPPT 433

  Fly   256 VKAISQLVGAPVEREVTLECIVEVFPKPLNGWYRSEGNIKLHNGNKYNISEEVINIYTWHLNLTI 320
            :......|.....|.||::|.|...||||..|.|:...:   .|.:||:..        :.:|.|
  Fly   434 ISEAPAAVSTVDGRNVTIKCRVNGSPKPLVKWLRASNWL---TGGRYNVQA--------NGDLEI 487

  Fly   321 RHLTKSDFGTYSCSSVNALGKSE---SLIRLQELRLPPKLTTTPTPHMQTTGKSRRKHPASHKKG 382
            :.:|.||.|.|:|.:.|..|:.:   ||:..:..|    :|..|..:....|:|           
  Fly   488 QDVTFSDAGKYTCYAQNKFGEIQADGSLVVKEHTR----ITQEPQNYEVAAGQS----------- 537

  Fly   383 LNEVLRFQETHFANQIQQENEDHNEGFDL-----LKFTNSENSNIV------LESGHINSMI-NK 435
              ...|..|.| .:.::.|.:...:|..:     .:|..:.::::.      |:||....:. .:
  Fly   538 --ATFRCNEAH-DDTLEIEIDWWKDGQSIDFEAQPRFVKTNDNSLTIAKTMELDSGEYTCVARTR 599

  Fly   436 EDVNIYHPKQYGQEKTNKPSGT-----IPSTRTPWILTNAGSQRPALTSYATVALITSFWLFFWR 495
            .|..........|:..|.|..|     .......|  ...|..|..:..| |:...||       
  Fly   600 LDEATARANLIVQDVPNAPKLTGITCQADKAEIHW--EQQGDNRSPILHY-TIQFNTS------- 654

  Fly   496 VFHSLDWDAIRVSSVVHHVVVFKRRSYFEAPN 527
             |....|||                :|.:.||
  Fly   655 -FTPASWDA----------------AYEKVPN 669

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-lambdaNP_001334747.1 IG_like 57..150 CDD:214653 15/85 (18%)
Ig strand B 67..71 CDD:409353 0/3 (0%)
Ig strand E 115..119 CDD:409353 1/3 (33%)
Ig strand F 129..134 CDD:409353 2/4 (50%)
Ig 153..250 CDD:472250 26/96 (27%)
Ig strand B 173..177 CDD:409353 0/3 (0%)
Ig strand C 186..190 CDD:409353 1/3 (33%)
Ig strand E 204..219 CDD:409353 2/14 (14%)
Ig strand F 229..234 CDD:409353 2/4 (50%)
Ig strand G 243..246 CDD:409353 1/2 (50%)
IG_like 271..349 CDD:214653 25/80 (31%)
Ig strand B 271..275 CDD:409353 2/3 (67%)
Ig strand C 284..288 CDD:409353 1/3 (33%)
Ig strand E 308..320 CDD:409353 1/11 (9%)
Ig strand F 330..335 CDD:409353 2/4 (50%)
NrgNP_001245581.1 Ig 29..128 CDD:472250
Ig strand B 55..59 CDD:409353
Ig strand C 68..72 CDD:409353
Ig strand E 94..98 CDD:409353
Ig strand F 108..113 CDD:409353
Ig strand G 122..125 CDD:409353
Ig 137..216 CDD:472250
Ig strand B 151..155 CDD:409353
Ig strand C 165..169 CDD:409353
Ig strand E 192..196 CDD:409353
Ig strand F 209..214 CDD:409353
ig 251..332 CDD:395002 15/84 (18%)
Ig strand B 264..268 CDD:409353 0/3 (0%)
Ig strand C 277..281 CDD:409353 0/3 (0%)
Ig strand E 305..309 CDD:409353 0/3 (0%)
Ig strand F 314..319 CDD:409353 2/4 (50%)
Ig strand G 328..331 CDD:409353 1/4 (25%)
IgI_4_hemolin-like 339..427 CDD:409570 27/95 (28%)
Ig strand A 339..342 CDD:409570 0/2 (0%)
Ig strand A' 348..351 CDD:409570 0/2 (0%)
Ig strand B 356..363 CDD:409570 1/6 (17%)
Ig strand C 369..374 CDD:409570 2/4 (50%)
Ig strand C' 377..379 CDD:409570 1/1 (100%)
Ig strand D 387..391 CDD:409570 1/7 (14%)
Ig strand E 393..397 CDD:409570 0/3 (0%)
Ig strand F 406..414 CDD:409570 4/7 (57%)
Ig strand G 417..427 CDD:409570 4/11 (36%)
Ig 446..517 CDD:472250 26/81 (32%)
Ig strand B 449..453 CDD:409358 2/3 (67%)
Ig strand C 462..466 CDD:409358 1/3 (33%)
Ig strand E 483..487 CDD:409358 1/3 (33%)
Ig strand F 497..502 CDD:409358 2/4 (50%)
Ig strand G 510..513 CDD:409358 0/2 (0%)
Ig 521..615 CDD:472250 16/111 (14%)
Ig strand B 538..542 CDD:409353 0/3 (0%)
Ig strand C 553..557 CDD:409353 1/3 (33%)
Ig strand E 577..581 CDD:409353 0/3 (0%)
Ig strand F 591..596 CDD:409353 0/4 (0%)
Ig strand G 604..607 CDD:409353 0/2 (0%)
FN3 613..707 CDD:238020 17/84 (20%)
FN3 683..>1051 CDD:442628
fn3 817..905 CDD:394996
fn3 918..1007 CDD:394996
FN3 1041..1111 CDD:238020
Bravo_FIGEY 1155..>1221 CDD:464016
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.