DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-lambda and NEGR1

DIOPT Version :9

Sequence 1:NP_001334747.1 Gene:DIP-lambda / 26067049 FlyBaseID:FBgn0267428 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_776169.2 Gene:NEGR1 / 257194 HGNCID:17302 Length:354 Species:Homo sapiens


Alignment Length:330 Identity:92/330 - (27%)
Similarity:136/330 - (41%) Gaps:65/330 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 LAKLSNTTVPIGRDISFT-CVVDNL----------------GHYRVAWIKSDSKAILGIHTHMVS 100
            |..|..:.:|.|:.:.|. ..|||:                |..:.||:...|....|  ....|
Human    24 LCCLLPSCLPAGQSVDFPWAAVDNMMVRKGDTAVLRCYLEDGASKGAWLNRSSIIFAG--GDKWS 86

  Fly   101 LNPRLSVTHNGHNTWKLHISRVQINDSGSYMCQVNTD-PMKSLSGYLDVVVPP---DILNHPEHN 161
            ::||:|::......:.|.|..|.:.|.|.|.|.|.|. ..:::..:|.|.|||   ||.|     
Human    87 VDPRVSISTLNKRDYSLQIQNVDVTDDGPYTCSVQTQHTPRTMQVHLTVQVPPKIYDISN----- 146

  Fly   162 PEDGVCQEGGSISLMCSVTGVPRPKVLWRREAGKEIILRTDGRDKTGFKSVE-GERLVLTNVQRS 225
              |....||.:::|.|..||.|.|.:.||..:             ...|..| |:.|.:..:.|.
Human   147 --DMTVNEGTNVTLTCLATGKPEPSISWRHIS-------------PSAKPFENGQYLDIYGITRD 196

  Fly   226 DMGGYNCIASNGIP-PSVSKRFNVYVNFSPTVKAISQLVGAPVEREVTLECIVEVFPKPLNGWYR 289
            ..|.|.|.|.|.:. |.| ::..|.|||:||::.|......| .|...:.|.....|.|...||:
Human   197 QAGEYECSAENDVSFPDV-RKVKVVVNFAPTIQEIKSGTVTP-GRSGLIRCEGAGVPPPAFEWYK 259

  Fly   290 SEGNIKLHNGNK----YNISEEVINIYTWHLNLTIRHLTKSDFGTYSCSSVNALGKSESLIRLQE 350
              |..||.||.:    .|.|...|        ||:.::|:..||.|:|.:.|.||.:.:.:.|. 
Human   260 --GEKKLFNGQQGIIIQNFSTRSI--------LTVTNVTQEHFGNYTCVAANKLGTTNASLPLN- 313

  Fly   351 LRLPP 355
               ||
Human   314 ---PP 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-lambdaNP_001334747.1 None
NEGR1NP_776169.2 IG 47..135 CDD:214652 20/89 (22%)
IGc2 152..210 CDD:197706 20/70 (29%)
Ig_3 225..301 CDD:372822 25/86 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I12195
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 1 1.000 - - FOG0000150
OrthoInspector 1 1.000 - - mtm8497
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.