DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-lambda and Ncam1

DIOPT Version :9

Sequence 1:NP_001334747.1 Gene:DIP-lambda / 26067049 FlyBaseID:FBgn0267428 Length:548 Species:Drosophila melanogaster
Sequence 2:XP_038936733.1 Gene:Ncam1 / 24586 RGDID:67378 Length:1136 Species:Rattus norvegicus


Alignment Length:432 Identity:93/432 - (21%)
Similarity:183/432 - (42%) Gaps:85/432 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 SNTTVPIGRDISFTC-VVDNLGHYRVAWIKSDSKAILGIHTHMVSLNP---RLSVTHNGHNTWKL 117
            |...:.:|....|.| |..:.....::|...:.:          .|:|   |:||..|..::..|
  Rat    27 SQGEISVGESKFFLCQVAGDAKDKDISWFSPNGE----------KLSPNQQRISVVWNDDDSSTL 81

  Fly   118 HISRVQINDSGSYMCQVNTDPMKSLSGYLDVVVPPDILNHPEHNPEDGVCQEGGSISLMCSVTGV 182
            .|....|:|:|.|.|.|..:........::|.:...::......|::  .:||....::|.|...
  Rat    82 TIYNANIDDAGIYKCVVTAEDGTQSEATVNVKIFQKLMFKNAPTPQE--FKEGEDAVIVCDVVSS 144

  Fly   183 PRPKVLWRREAGKEIILRTDGRDKTGFKSVEGERLVLTNVQRSDMGGYNC---IASNGIPPSVS- 243
            ..|.::|:.: |:::||:.|.|    |..:....|.:..::::|.|.|.|   |.:.|   .:: 
  Rat   145 LPPTIIWKHK-GRDVILKKDVR----FIVLSNNYLQIRGIKKTDEGTYRCEGRILARG---EINF 201

  Fly   244 KRFNVYVNFSPTVKAISQLVGAPVE--REVTLECIVEVFPKPLNGWYRSEGNI--KLHNGNKYNI 304
            |...|.||..|||:|...:|.|...  :.|||.|..:.||:|...|.:....|  :..:..|:..
  Rat   202 KDIQVIVNVPPTVQARQSIVNATANLGQSVTLVCDADGFPEPTMSWTKDGEPIENEEEDDEKHIF 266

  Fly   305 SEEVINIYTWHLNLTIRHLTKSDFGTYSCSSVNALGKSESLIRLQ--------------ELRLPP 355
            |::       ...||||::.|:|...|.|.:.|..|:.::.|.|:              .:.|..
  Rat   267 SDD-------SSELTIRNVDKNDEAEYVCIAENKAGEQDASIHLKVFAKPKITYVENQTAMELEE 324

  Fly   356 KLTTT------PTPHMQTTGKSRRKHPASHKKGLNEVLRFQETHFANQIQQENEDHNEGFDLLKF 414
            ::|.|      |.|.:  |.::..::.:|.:|             |:..:.|.::..:|..::: 
  Rat   325 QVTLTCEASGDPIPSI--TWRTSTRNISSEEK-------------ASWTRPEKQETLDGHMVVR- 373

  Fly   415 TNSENSNIVLES------GH----INSMINKEDVNIYHPKQY 446
            :::..|::.|:|      |.    .::.|.::..::|...||
  Rat   374 SHARVSSLTLKSIQYTDAGEYICTASNTIGQDSQSMYLEVQY 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-lambdaNP_001334747.1 None
Ncam1XP_038936733.1 IgI_1_NCAM-1 20..116 CDD:409451 21/98 (21%)
Ig strand B 37..41 CDD:409451 1/3 (33%)
Ig strand C 51..55 CDD:409451 0/3 (0%)
Ig strand E 79..83 CDD:409451 1/3 (33%)
Ig strand F 93..98 CDD:409451 2/4 (50%)
Ig strand G 107..110 CDD:409451 0/2 (0%)
IG_like 124..190 CDD:214653 17/72 (24%)
Ig strand B 135..139 CDD:409353 0/3 (0%)
Ig strand C 148..152 CDD:409353 0/3 (0%)
Ig strand E 172..176 CDD:409353 1/3 (33%)
Ig strand F 186..191 CDD:409353 2/4 (50%)
IgI_3_NCAM-1 211..308 CDD:143207 29/103 (28%)
Ig strand B 231..235 CDD:143207 3/3 (100%)
Ig strand C 244..248 CDD:143207 0/3 (0%)
Ig strand E 271..275 CDD:143207 1/3 (33%)
Ig strand F 285..290 CDD:143207 2/4 (50%)
Ig strand G 298..301 CDD:143207 0/2 (0%)
IgI_NCAM-1 307..413 CDD:143277 17/121 (14%)
Ig strand B 326..330 CDD:143277 1/3 (33%)
Ig strand C 339..343 CDD:143277 1/5 (20%)
Ig strand E 379..383 CDD:143277 1/3 (33%)
Ig strand F 393..398 CDD:143277 0/4 (0%)
Ig strand G 406..409 CDD:143277 0/2 (0%)
Ig_3 422..494 CDD:404760
Ig strand B 433..437 CDD:409353
Ig strand C 446..450 CDD:409353
Ig strand E 473..477 CDD:409353
Ig strand F 487..492 CDD:409353
FN3 509..606 CDD:238020
fn3 619..701 CDD:394996
Herpes_BLLF1 <842..1133 CDD:282904
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12231
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.