DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-lambda and IGSF9B

DIOPT Version :10

Sequence 1:NP_001334747.1 Gene:DIP-lambda / 26067049 FlyBaseID:FBgn0267428 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_001264214.1 Gene:IGSF9B / 22997 HGNCID:32326 Length:1437 Species:Homo sapiens


Alignment Length:371 Identity:88/371 - (23%)
Similarity:140/371 - (37%) Gaps:82/371 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 IKAITITKCHAVAHIHGKGESEEIDPQFLAKLSNTTVPIGRDISFTC-----VVDNLGHYRVAWI 84
            |.::..|:..|....||..|    :|:|:      |...|..:...|     |......|.|.|.
Human     9 IASVIGTRGLAAEGAHGLRE----EPEFV------TARAGESVVLRCDVIHPVTGQPPPYVVEWF 63

  Fly    85 KSDSKAILGIHT--------HMVSLNPRLSVTHNGHNTWKLHISRVQINDSGSYMCQV-----NT 136
            |      .|:..        :...::|..:...:.|:...|.:.:|:..|.|.|.|:|     ..
Human    64 K------FGVPIPIFIKFGYYPPHVDPEYAGRASLHDKASLRLEQVRSEDQGWYECKVLMLDQQY 122

  Fly   137 DPMKSLSG-YLDVVVPPDILNHPEHNPEDGVCQEGGSISLMCSVTGVPRPKVLWRREAGKEIILR 200
            |...:.|. :|.:..||.....|   |:....:|||||::.|:..|.|:|.|.|.:|.   .:|.
Human   123 DTFHNGSWVHLTINAPPTFTETP---PQYIEAKEGGSITMTCTAFGNPKPIVTWLKEG---TLLG 181

  Fly   201 TDGRDKTGFKSVEGERLVLTNVQRSDMGGYNCIASN--------------GIPPSVSKRFNVYVN 251
            ..|:    ::..:|. |.:|:|.|.|.|.|.|.|.:              |.|..||...|:.||
Human   182 ASGK----YQVSDGS-LTVTSVSREDRGAYTCRAYSIQGEAVHTTHLLVQGPPFIVSPPENITVN 241

  Fly   252 FSPTVKAISQLVGAPVEREVTLECIVEVFPKPLN-GWYRSEGNIKLHNGNKYNISEEVINIYTWH 315
            .|               ::..|.|..|.:|..|. .||..:.|:...|..|..:...:..     
Human   242 IS---------------QDALLTCRAEAYPGNLTYTWYWQDENVYFQNDLKLRVRILIDG----- 286

  Fly   316 LNLTIRHLTKSDFGTYSCSSVNALGKSESLIRLQELRLPPKLTTTP 361
             .|.|..:...|.|.|:|...|:||:|.|......::.|.::...|
Human   287 -TLIIFRVKPEDSGKYTCVPSNSLGRSPSASAYLTVQYPARVLNMP 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-lambdaNP_001334747.1 IG_like 57..150 CDD:214653 21/111 (19%)
Ig strand B 67..71 CDD:409353 0/3 (0%)
Ig strand E 115..119 CDD:409353 1/3 (33%)
Ig strand F 129..134 CDD:409353 2/4 (50%)
Ig 153..250 CDD:472250 31/110 (28%)
Ig strand B 173..177 CDD:409353 1/3 (33%)
Ig strand C 186..190 CDD:409353 1/3 (33%)
Ig strand E 204..219 CDD:409353 2/14 (14%)
Ig strand F 229..234 CDD:409353 2/4 (50%)
Ig strand G 243..246 CDD:409353 1/2 (50%)
IG_like 271..349 CDD:214653 21/78 (27%)
Ig strand B 271..275 CDD:409353 1/3 (33%)
Ig strand C 284..288 CDD:409353 1/4 (25%)
Ig strand E 308..320 CDD:409353 1/11 (9%)
Ig strand F 330..335 CDD:409353 2/4 (50%)
IGSF9BNP_001264214.1 IG_like 30..115 CDD:214653 19/96 (20%)
Ig strand B 41..45 CDD:409353 0/3 (0%)
Ig strand C 59..63 CDD:409353 1/3 (33%)
Ig strand E 96..100 CDD:409353 1/3 (33%)
Ig strand F 110..115 CDD:409353 2/4 (50%)
I-set 139..225 CDD:400151 27/96 (28%)
Ig strand B 157..161 CDD:409353 1/3 (33%)
Ig strand C 170..174 CDD:409353 1/3 (33%)
Ig strand E 191..195 CDD:409353 2/4 (50%)
Ig strand F 205..210 CDD:409353 2/4 (50%)
Ig strand G 218..221 CDD:409353 0/2 (0%)
Ig_3 228..307 CDD:464046 23/99 (23%)
Ig 336..410 CDD:472250
Ig strand B 342..346 CDD:409353
Ig strand C 355..360 CDD:409353
Ig strand E 380..384 CDD:409353
Ig strand F 394..399 CDD:409353
Ig strand G 407..410 CDD:409353
Ig 429..505 CDD:472250
Ig strand B 438..442 CDD:409353
Ig strand C 451..455 CDD:409353
Ig strand E 471..475 CDD:409353
Ig strand F 485..490 CDD:409353
FN3 <490..>731 CDD:442628
Ig strand G 498..501 CDD:409353
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 758..817
PHA03247 <894..1242 CDD:223021
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 911..1081
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.