DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-lambda and IGSF9B

DIOPT Version :9

Sequence 1:NP_001334747.1 Gene:DIP-lambda / 26067049 FlyBaseID:FBgn0267428 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_001264214.1 Gene:IGSF9B / 22997 HGNCID:32326 Length:1437 Species:Homo sapiens


Alignment Length:371 Identity:88/371 - (23%)
Similarity:140/371 - (37%) Gaps:82/371 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 IKAITITKCHAVAHIHGKGESEEIDPQFLAKLSNTTVPIGRDISFTC-----VVDNLGHYRVAWI 84
            |.::..|:..|....||..|    :|:|:      |...|..:...|     |......|.|.|.
Human     9 IASVIGTRGLAAEGAHGLRE----EPEFV------TARAGESVVLRCDVIHPVTGQPPPYVVEWF 63

  Fly    85 KSDSKAILGIHT--------HMVSLNPRLSVTHNGHNTWKLHISRVQINDSGSYMCQV-----NT 136
            |      .|:..        :...::|..:...:.|:...|.:.:|:..|.|.|.|:|     ..
Human    64 K------FGVPIPIFIKFGYYPPHVDPEYAGRASLHDKASLRLEQVRSEDQGWYECKVLMLDQQY 122

  Fly   137 DPMKSLSG-YLDVVVPPDILNHPEHNPEDGVCQEGGSISLMCSVTGVPRPKVLWRREAGKEIILR 200
            |...:.|. :|.:..||.....|   |:....:|||||::.|:..|.|:|.|.|.:|.   .:|.
Human   123 DTFHNGSWVHLTINAPPTFTETP---PQYIEAKEGGSITMTCTAFGNPKPIVTWLKEG---TLLG 181

  Fly   201 TDGRDKTGFKSVEGERLVLTNVQRSDMGGYNCIASN--------------GIPPSVSKRFNVYVN 251
            ..|:    ::..:|. |.:|:|.|.|.|.|.|.|.:              |.|..||...|:.||
Human   182 ASGK----YQVSDGS-LTVTSVSREDRGAYTCRAYSIQGEAVHTTHLLVQGPPFIVSPPENITVN 241

  Fly   252 FSPTVKAISQLVGAPVEREVTLECIVEVFPKPLN-GWYRSEGNIKLHNGNKYNISEEVINIYTWH 315
            .|               ::..|.|..|.:|..|. .||..:.|:...|..|..:...:..     
Human   242 IS---------------QDALLTCRAEAYPGNLTYTWYWQDENVYFQNDLKLRVRILIDG----- 286

  Fly   316 LNLTIRHLTKSDFGTYSCSSVNALGKSESLIRLQELRLPPKLTTTP 361
             .|.|..:...|.|.|:|...|:||:|.|......::.|.::...|
Human   287 -TLIIFRVKPEDSGKYTCVPSNSLGRSPSASAYLTVQYPARVLNMP 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-lambdaNP_001334747.1 None
IGSF9BNP_001264214.1 IG_like 30..115 CDD:214653 19/96 (20%)
Ig 41..115 CDD:143165 15/79 (19%)
I-set 139..225 CDD:254352 27/96 (28%)
IGc2 153..210 CDD:197706 23/64 (36%)
I-set 229..321 CDD:254352 28/112 (25%)
Ig 235..321 CDD:299845 25/106 (24%)
IG_like 331..414 CDD:214653 1/1 (100%)
Ig <353..414 CDD:299845
IG_like 426..505 CDD:214653
Ig 442..505 CDD:299845
FN3 510..601 CDD:238020
FN3 617..699 CDD:238020
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 758..817
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 911..1081
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12231
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.