Sequence 1: | NP_001334747.1 | Gene: | DIP-lambda / 26067049 | FlyBaseID: | FBgn0267428 | Length: | 548 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001157990.1 | Gene: | Iglon5 / 210094 | MGIID: | 2686277 | Length: | 336 | Species: | Mus musculus |
Alignment Length: | 317 | Identity: | 91/317 - (28%) |
---|---|---|---|
Similarity: | 142/317 - (44%) | Gaps: | 35/317 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 51 QFLAKLSNTTVPIGRDISFTCVVDNLGHY-RVAWIKSDSKAILGIHTHMVSLNPRLSVTHNGHNT 114
Fly 115 WKLHISRVQINDSGSYMCQVNT--DPMKSLSGYLDVVVPPDILNHPEHNPEDGVCQEGGSISLMC 177
Fly 178 SVTGVPRPKVLWRREAGKEIILRTDGRDKTGFKSVEGERLVLTNVQRSDMGGYNCIASNGIPPSV 242
Fly 243 -SKRFNVYVNFSPTVKAISQLVGAPVEREVTLECIVEVFPKPLNGWYRSEGNIKLHNGNKYNISE 306
Fly 307 EVINIYTWHLNLTIRHLTKSDFGTYSCSSVNALGKSESLIRLQELRLPPKLTTTPTP 363 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
DIP-lambda | NP_001334747.1 | None | |||
Iglon5 | NP_001157990.1 | Ig | 41..129 | CDD:416386 | 26/92 (28%) |
Ig strand A' | 41..46 | CDD:409353 | 3/4 (75%) | ||
Ig strand B | 48..56 | CDD:409353 | 1/7 (14%) | ||
CDR1 | 56..60 | CDD:409353 | 1/5 (20%) | ||
FR2 | 61..68 | CDD:409353 | 4/6 (67%) | ||
Ig strand C | 61..67 | CDD:409353 | 4/5 (80%) | ||
CDR2 | 69..79 | CDD:409353 | 2/11 (18%) | ||
Ig strand C' | 71..74 | CDD:409353 | 2/2 (100%) | ||
Ig strand C' | 76..79 | CDD:409353 | 0/2 (0%) | ||
FR3 | 80..115 | CDD:409353 | 9/34 (26%) | ||
Ig strand D | 84..91 | CDD:409353 | 1/6 (17%) | ||
Ig strand E | 94..100 | CDD:409353 | 0/5 (0%) | ||
Ig strand F | 107..115 | CDD:409353 | 3/7 (43%) | ||
CDR3 | 116..120 | CDD:409353 | 1/3 (33%) | ||
Ig strand G | 120..129 | CDD:409353 | 3/9 (33%) | ||
FR4 | 122..129 | CDD:409353 | 2/6 (33%) | ||
Ig strand A | 132..137 | CDD:409353 | 2/4 (50%) | ||
Ig_3 | 134..199 | CDD:404760 | 28/82 (34%) | ||
Ig strand A' | 140..145 | CDD:409353 | 1/6 (17%) | ||
Ig strand B | 148..157 | CDD:409353 | 3/8 (38%) | ||
Ig strand C | 163..167 | CDD:409353 | 1/3 (33%) | ||
Ig strand D | 174..177 | CDD:409353 | 1/3 (33%) | ||
Ig strand E | 178..183 | CDD:409353 | 2/4 (50%) | ||
Ig strand F | 191..199 | CDD:409353 | 3/7 (43%) | ||
Ig_3 | 217..295 | CDD:404760 | 16/83 (19%) | ||
putative Ig strand A | 218..224 | CDD:409353 | 2/5 (40%) | ||
Ig strand B | 234..238 | CDD:409353 | 1/3 (33%) | ||
Ig strand C | 247..251 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 274..278 | CDD:409353 | 0/3 (0%) | ||
Ig strand F | 288..293 | CDD:409353 | 2/4 (50%) | ||
Ig strand G | 301..304 | CDD:409353 | 0/2 (0%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 45 | 1.000 | Domainoid score | I12107 |
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 142 | 1.000 | Inparanoid score | I4449 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D265311at33208 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0000150 | |
OrthoInspector | 1 | 1.000 | - | - | mtm8732 | |
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X97 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
7 | 6.970 |