DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-lambda and wrk-1

DIOPT Version :10

Sequence 1:NP_001334747.1 Gene:DIP-lambda / 26067049 FlyBaseID:FBgn0267428 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_001024651.1 Gene:wrk-1 / 181093 WormBaseID:WBGene00006942 Length:452 Species:Caenorhabditis elegans


Alignment Length:493 Identity:111/493 - (22%)
Similarity:189/493 - (38%) Gaps:136/493 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 GRDISFTCVVDNLGHYRVAWIKSDSKAILGIHTHMVSLNPRLSVTHNGH------NTWKLHISRV 122
            |..::..|.|:: ....:.|.|         :|.:|:::..:..|:.|:      :|..|.|.||
 Worm    32 GESLTLRCEVED-PSVAIIWRK---------NTEVVAVDDEILDTYGGYEISMEGSTSVLTIKRV 86

  Fly   123 QINDSGSYMCQVNTDPMKSLSGYLDVVV--PPDILNHP--EHNPEDGV--CQEG-GSISLMCSV- 179
            :..:|.:|.|.: .:|..|::..:.|.|  |..:...|  ..:|:.||  .:.| .::.:.|.| 
 Worm    87 EPINSANYSCAL-AEPEVSVTFVIKVQVFKPTQVSVKPLVVISPDTGVYHARVGEKNLVITCHVK 150

  Fly   180 TGVPRPKVLWRREAGK--EIILRTDGRDKTGFKSVEGERLVLTNVQRSDMGGYNCIASNGIPPSV 242
            .|.|:|.|:|.::|.|  |.|.|..|          |.|:|:|.|::...|.|||:|.| |..|.
 Worm   151 EGNPKPGVVWTKQAAKLPEDIKREHG----------GARIVITEVKKHHAGKYNCLAEN-IAGSD 204

  Fly   243 SKRFNVYV--------NFSPTVKAISQLVGAPVEREVTLECIVEVFPKPLNGWYRSEGNIKLHNG 299
            ....:::|        ...|.||.....:.....:..:..|..:..|.|...|        |.||
 Worm   205 RATIDIHVAEPLQGEREEKPWVKNEDTFIPVRKNQNASFWCTYDGTPVPQVEW--------LFNG 261

  Fly   300 NKYNISEEV----------INIYTWHLNLTIRHLTKSDFGTYSCSSVNALGKSESLIRLQELRLP 354
            .|.|.::|.          :|.|: ...||:..:::..||.|:|...|.||...:::.:.....|
 Worm   262 YKINFNDEKFKKTSETAQRLNGYS-KSTLTVGDISEEAFGDYACRISNKLGSVTAVVHVSGRPGP 325

  Fly   355 PKLTTTPTPHMQTTGKSRRKHPASHKKGLNEVLRFQETHFANQIQQENEDH-------------- 405
            |:|:...:....|.            :..:::|.:|..|     :.||.||              
 Worm   326 PQLSFDESELTWTV------------RAFDKILEYQLCH-----RLENADHFLPEDCNSVRVKKS 373

  Fly   406 -NEGFDLLKFTNSENSNIVLESGHINSMINKEDVNI---------------YHPKQYGQEKTNKP 454
             |.|.|  |:|::.:.:..||.|      ||..|.:               .|.:....||....
 Worm   374 DNNGDD--KWTHTIDLSTFLEHG------NKYHVQLKARNALGWGSMAKDALHVELQRIEKEEAK 430

  Fly   455 SGTIPSTRTPWILTNAGSQRPALTSYATVALITSFWLF 492
            ..:|.|                :.|...|.|:|.:.||
 Worm   431 GASIIS----------------IISSILVTLVTMYLLF 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-lambdaNP_001334747.1 IG_like 57..150 CDD:214653 20/91 (22%)
Ig strand B 67..71 CDD:409353 0/3 (0%)
Ig strand E 115..119 CDD:409353 1/3 (33%)
Ig strand F 129..134 CDD:409353 2/4 (50%)
Ig 153..250 CDD:472250 31/104 (30%)
Ig strand B 173..177 CDD:409353 0/3 (0%)
Ig strand C 186..190 CDD:409353 1/3 (33%)
Ig strand E 204..219 CDD:409353 2/14 (14%)
Ig strand F 229..234 CDD:409353 3/4 (75%)
Ig strand G 243..246 CDD:409353 0/2 (0%)
IG_like 271..349 CDD:214653 21/87 (24%)
Ig strand B 271..275 CDD:409353 0/3 (0%)
Ig strand C 284..288 CDD:409353 0/3 (0%)
Ig strand E 308..320 CDD:409353 3/21 (14%)
Ig strand F 330..335 CDD:409353 2/4 (50%)
wrk-1NP_001024651.1 IG_like 25..113 CDD:214653 20/91 (22%)
Ig strand B 35..39 CDD:409353 0/3 (0%)
Ig strand C 47..51 CDD:409353 0/3 (0%)
Ig strand E 77..83 CDD:409353 2/5 (40%)
Ig strand F 93..98 CDD:409353 2/4 (50%)
Ig strand G 104..107 CDD:409353 1/2 (50%)
Ig 136..212 CDD:472250 27/86 (31%)
Ig strand B 143..147 CDD:409353 0/3 (0%)
Ig strand C 157..161 CDD:409353 1/3 (33%)
Ig strand E 178..182 CDD:409353 1/3 (33%)
Ig strand F 192..197 CDD:409353 3/4 (75%)
Ig 235..319 CDD:472250 21/92 (23%)
Ig strand C 254..258 CDD:409353 1/11 (9%)
Ig strand E 278..291 CDD:409353 3/13 (23%)
Ig strand F 301..306 CDD:409353 2/4 (50%)
Ig strand G 314..317 CDD:409353 0/2 (0%)

Return to query results.
Submit another query.