DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-lambda and EMB

DIOPT Version :9

Sequence 1:NP_001334747.1 Gene:DIP-lambda / 26067049 FlyBaseID:FBgn0267428 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_940851.1 Gene:EMB / 133418 HGNCID:30465 Length:327 Species:Homo sapiens


Alignment Length:256 Identity:65/256 - (25%)
Similarity:98/256 - (38%) Gaps:42/256 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 SISLMCSVT---GVPRPKVLWRREAGKEIILRTDGRDKTGFKSVEGERLV----LTNVQRSDMGG 229
            :::|.|..|   .:....|.|::: |:::       :.....|..|..|.    .|.:....||.
Human    83 NVNLTCQFTTSGDLNAVNVTWKKD-GEQL-------ENNYLVSATGSTLYTQYRFTIINSKQMGS 139

  Fly   230 YNCIASNGIPPSVSKRFNVYVNFSPTVKAISQLVGAPVEREVTLECIVEVFPKPLN-GWYRSEGN 293
            |:|..........:..|.|..........||.:..:.|   :|.:| ...|  ||| .||.|.|:
Human   140 YSCFFREEKEQRGTFNFKVPELHGKNKPLISYVGDSTV---LTCKC-QNCF--PLNWTWYSSNGS 198

  Fly   294 IKLHNG---NKYNISEEVIN-IYTWHLNLTIRHLTKSDFGTYSCSSVNALGKSESLIRLQELR-- 352
            :|:..|   |||     ||| .|.....|.|..|.:.|..:|.|.::..||:||..|.|..|.  
Human   199 VKVPVGVQMNKY-----VINGTYANETKLKITQLLEEDGESYWCRALFQLGESEEHIELVVLSYL 258

  Fly   353 --LPPKLT-TTPTPHMQTTGKSRRKHPASHKKGLNEVLRFQETHFANQIQQENEDHNEGFD 410
              |.|.|. ......:..|.....|:....||..:|...|:      ||:|...|.:.|.:
Human   259 VPLKPFLVIVAEVILLVATILLCEKYTQKKKKHSDEGKEFE------QIEQLKSDDSNGIE 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-lambdaNP_001334747.1 None
EMBNP_940851.1 Ig 82..143 CDD:325142 13/67 (19%)
IG_like 172..254 CDD:214653 32/92 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 287..327 9/33 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.