DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-lambda and ncam1b

DIOPT Version :9

Sequence 1:NP_001334747.1 Gene:DIP-lambda / 26067049 FlyBaseID:FBgn0267428 Length:548 Species:Drosophila melanogaster
Sequence 2:XP_005157462.1 Gene:ncam1b / 114442 ZFINID:ZDB-GENE-010822-2 Length:1055 Species:Danio rerio


Alignment Length:376 Identity:96/376 - (25%)
Similarity:151/376 - (40%) Gaps:83/376 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 VPIGRDISFTCVVDNLGHYRVAWIKSDSKAILGIHTHMVSLNPRLSVTHNGHNTWKLHISRVQIN 125
            :.:|....|.|.|.. |...:.|.....:.|       ....|.:||..|...:..|.|...:::
Zfish    31 ISVGESRFFLCEVIG-GAKEIDWFAPAGEKI-------EPGRPDISVIRNDETSSTLTIYNAKVD 87

  Fly   126 DSGSYMCQVNT-DPMKSLSGYLDVVVPPDILNHPEHNPEDGVCQEGGSISLMCSVTGVPRPKVLW 189
            ::|:|.|..:: |.....:..|.:.......|.|  :|::  ..||.:..::|.|...|.|.|||
Zfish    88 NAGTYRCVASSGDQDAEATVNLKIYQKITFTNVP--SPQE--FTEGDNAIIVCDVISSPPPTVLW 148

  Fly   190 RREAGKEIILRTDGRDKTGFKSVEGERLVLTNVQRSDMGGYNC---IASNGIPPSVSKR-FNVYV 250
            :.: |.:|....|.|    ||::....|.:..::::|.|.|.|   |.:.|   .|..| ..|.|
Zfish   149 KYK-GAKIQFDKDVR----FKTLSNNHLQIRGIRKTDEGVYTCEGRIKARG---EVDFRSIKVVV 205

  Fly   251 NFSPTVKAISQLVGAPVER--EVTLECIVEVFPKPLNGWYRSEGNIKLHNGNKYNISEEVINIYT 313
            |..||::.......|..:.  ...|.|..:.||:|:..|.|:  |..|.:||||:.:|:      
Zfish   206 NVLPTIRIRQAETNATADMGFSTLLACDPDGFPEPIVTWRRN--NAPLESGNKYSFNED------ 262

  Fly   314 WHLNLTIRHLTKSDFGTYSCSSVNALGKSESLIRLQELRL----PPKL------TTT-------- 360
             ...:|:..:||.|.|.|:|.:.|..|:||     |||.|    .||:      |||        
Zfish   263 -GSEMTVLDVTKLDEGDYTCIAKNKAGESE-----QELSLKVFVQPKITYLESQTTTEMDEQVTL 321

  Fly   361 -------PTP--------HMQTTGKSRRK---------HPASHKKGLNEVL 387
                   |||        .:.|.|:..::         .|..||....|||
Zfish   322 TCEATGDPTPTITWSFGTRVFTEGEQEQQKRIYQASWTRPEQHKGPDGEVL 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-lambdaNP_001334747.1 None
ncam1bXP_005157462.1 Ig 20..112 CDD:299845 18/88 (20%)
I-set 21..111 CDD:254352 18/87 (21%)
IG_like 121..205 CDD:214653 27/95 (28%)
IGc2 128..189 CDD:197706 20/65 (31%)
Ig 208..301 CDD:299845 32/106 (30%)
I-set 212..298 CDD:254352 30/99 (30%)
I-set 298..414 CDD:254352 16/75 (21%)
Ig 300..414 CDD:299845 16/73 (22%)
IG_like 426..505 CDD:214653
Ig 434..505 CDD:143165
FN3 513..606 CDD:238020
FN3 629..720 CDD:238020
Chorion_3 <815..1019 CDD:253174
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12231
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.