DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-lambda and chl1b

DIOPT Version :10

Sequence 1:NP_001334747.1 Gene:DIP-lambda / 26067049 FlyBaseID:FBgn0267428 Length:548 Species:Drosophila melanogaster
Sequence 2:XP_017212175.2 Gene:chl1b / 100318566 ZFINID:ZDB-GENE-091105-1 Length:1294 Species:Danio rerio


Alignment Length:449 Identity:99/449 - (22%)
Similarity:172/449 - (38%) Gaps:93/449 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 CSIAFILIKAITITKCHAVAHI-------------HGKGESE---EIDPQFLAKL---SNTTVPI 63
            |..||..|:  ||.:..|::.:             .|:|.:.   |..|..||..   |:|.:..
Zfish   213 CFAAFPRIR--TIVQKTAMSMVVKSNKLMKDSSSGSGRGYANSLLERKPSLLAPTGMESHTRLVK 275

  Fly    64 GRDISFTCVVDNLGHYRVAWIKSDSKAILGIHTHMVSLNPRLSVTHNGHNTWKLHISRVQINDSG 128
            |.|:...|:.:.....:|.|:|      :|.:    .|..|:.|..:|.   .|.:..|...|.|
Zfish   276 GEDLQLECIAEGFPTPKVEWVK------IGFN----KLPERVVVESHGK---LLTVEMVNEEDEG 327

  Fly   129 SYMCQVNTDPMKSLSGYLDVVV--PPDILNHPEHNPEDGVCQEGGSISLMCSVTGVPRPKVLWRR 191
            .|||:.. :|...:..:..|.|  ||:.    |..|:..:...|..:.:.|.|.|.|:|.|.||.
Zfish   328 KYMCRAK-NPHGEVVHHFHVTVEEPPEF----EIEPQSQLVTIGADVLIKCVVKGNPQPTVGWRV 387

  Fly   192 EAGKEIILRTDGRDKTGFKSVEGERLVLTNVQRSDMGGYNCIASNGIPPSVSKRFNVYVNFSPTV 256
            .......:.|..|     |.::...:.:.|....:...|.|.|:|.....::....:.:|..|.:
Zfish   388 NGRPLNEVPTSNR-----KILKDGTISIHNANPENSAVYQCEATNKHGTILANANIMIMNIQPLI 447

  Fly   257 KAISQLVGAPVE-REVTLECIVEVFPKPLNG--WYRSEGNIKLHNGNKYNISEEVINIYTWHLN- 317
            ...:.|....|| :.|.:.|  :||..|.:.  |.::: :.....|.::.:          |.| 
Zfish   448 LTENNLQYMAVEGKSVVMHC--KVFSSPASSITWSKAD-SANAVEGERFTV----------HQNG 499

  Fly   318 -LTIRHLTKSDFGTYSCSSVNALGKSESLIRLQELRLPPKLTTTPTPHMQTTGKSRRKHPASHKK 381
             |.|.::.|.|.|.|||.:.|..|| .::....|::.|.::...|                   :
Zfish   500 SLEIHNVMKEDMGEYSCFAQNTEGK-VAIAATLEVKDPTRIVDPP-------------------R 544

  Fly   382 GLNEVLRFQETHFANQIQQENEDHNEGFDLL------KFTNSENSNIVLESGHINSMIN 434
            .| .||......|:.| .:.:....:.|::|      ....||:...:||.| :..:||
Zfish   545 DL-RVLAGTTIQFSCQ-PEFDPSFGDDFEVLWEKDGIALNGSEDGRYILEDG-VLEIIN 600

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-lambdaNP_001334747.1 IG_like 57..150 CDD:214653 22/92 (24%)
Ig strand B 67..71 CDD:409353 0/3 (0%)
Ig strand E 115..119 CDD:409353 1/3 (33%)
Ig strand F 129..134 CDD:409353 3/4 (75%)
Ig 153..250 CDD:472250 19/96 (20%)
Ig strand B 173..177 CDD:409353 0/3 (0%)
Ig strand C 186..190 CDD:409353 1/3 (33%)
Ig strand E 204..219 CDD:409353 2/14 (14%)
Ig strand F 229..234 CDD:409353 2/4 (50%)
Ig strand G 243..246 CDD:409353 0/2 (0%)
IG_like 271..349 CDD:214653 20/81 (25%)
Ig strand B 271..275 CDD:409353 1/3 (33%)
Ig strand C 284..288 CDD:409353 0/5 (0%)
Ig strand E 308..320 CDD:409353 3/13 (23%)
Ig strand F 330..335 CDD:409353 3/4 (75%)
chl1bXP_017212175.2 Ig 42..135 CDD:472250
Ig strand B 61..65 CDD:409396
Ig strand C 74..78 CDD:409396
Ig strand E 99..103 CDD:409396
Ig strand F 115..120 CDD:409396
Ig strand G 129..132 CDD:409396
Ig 144..234 CDD:472250 7/22 (32%)
Ig strand B 158..162 CDD:409432
Ig strand C 172..176 CDD:409432
Ig strand E 195..199 CDD:409432
Ig strand F 210..215 CDD:409432 1/1 (100%)
Ig strand G 226..229 CDD:409432 0/2 (0%)
Ig 267..348 CDD:472250 22/94 (23%)
Ig strand B 279..283 CDD:409394 0/3 (0%)
Ig strand C 292..296 CDD:409394 1/3 (33%)
Ig strand E 314..318 CDD:409394 1/6 (17%)
Ig strand F 328..333 CDD:409394 3/4 (75%)
Ig strand G 341..344 CDD:409394 0/2 (0%)
Ig 359..438 CDD:472250 17/83 (20%)
Ig strand B 369..373 CDD:409367 0/3 (0%)
Ig strand C 382..386 CDD:409367 1/3 (33%)
Ig strand E 406..410 CDD:409367 0/3 (0%)
Ig strand F 420..425 CDD:409367 2/4 (50%)
Ig strand G 433..436 CDD:409367 0/2 (0%)
Ig 447..533 CDD:472250 23/99 (23%)
Ig strand B 463..467 CDD:409544 1/3 (33%)
Ig strand C 476..480 CDD:409544 0/3 (0%)
Ig strand E 499..503 CDD:409544 1/3 (33%)
Ig strand F 513..518 CDD:409544 3/4 (75%)
Ig strand G 526..529 CDD:409544 0/2 (0%)
Ig 535..635 CDD:472250 16/88 (18%)
Ig strand B 554..558 CDD:409359 1/3 (33%)
Ig strand C 571..575 CDD:409359 1/3 (33%)
Ig strand E 594..598 CDD:409359 1/4 (25%)
Ig strand F 608..613 CDD:409359
Ig strand G 621..624 CDD:409359
FN3 632..722 CDD:238020
FN3 <702..1101 CDD:442628
FN3 1070..1142 CDD:214495
Bravo_FIGEY 1196..1279 CDD:464016
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.