DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-lambda and lsamp

DIOPT Version :9

Sequence 1:NP_001334747.1 Gene:DIP-lambda / 26067049 FlyBaseID:FBgn0267428 Length:548 Species:Drosophila melanogaster
Sequence 2:XP_031751462.1 Gene:lsamp / 100124984 XenbaseID:XB-GENE-5759171 Length:368 Species:Xenopus tropicalis


Alignment Length:337 Identity:87/337 - (25%)
Similarity:136/337 - (40%) Gaps:50/337 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 FLAKLSNTTVPIGRDISFTCVVDNLGHYRVAWIKSDSKAILGIHTHMVSLNPRLSVTHNGHNTWK 116
            |.....|.||..|......|.|::... ||||:  :...|:.......||:||:.:.......:.
 Frog    34 FNRSTDNITVRQGDTAILRCFVEDRSS-RVAWL--NRSGIIFAGDDKWSLDPRVELEKRSLLEYS 95

  Fly   117 LHISRVQINDSGSYMCQVNT-DPMKSLSGYLDVVVPPDILNHPEHNPEDGVCQEGGSISLMCSVT 180
            |.|.:|.::|.|.|.|.|.| ...|:...||.|.|||.|.|    ...|....||.:::|||...
 Frog    96 LRIQKVDVSDEGPYTCSVQTKQHTKTTQVYLIVQVPPKISN----ISADITVNEGSNVTLMCIAY 156

  Fly   181 GVPRPKVLWRR---EAGKEIILRTDGRDKTGFKSVEGERLVLTNVQRSDMGGYNCIASNGIPPSV 242
            |.|.|.:.||.   .||     .:..||..|    |.|.|.:..:.|...|.|.|.|:|.:..:.
 Frog   157 GRPEPMITWRHLTPTAG-----TSPARDFEG----EEEFLEIQGITREQSGRYECKAANEVASAD 212

  Fly   243 SKRFNVYVNFSPTVKAISQLVGAPVEREVTLECIVEVFPKPLNGWYR---------SEGNIKLHN 298
            .|:..|.||:.|.:.. |:...|...::..|.|.....|.|...||:         |...:::.|
 Frog   213 VKQVRVTVNYPPIITE-SKSNEATTGKQAILRCEASAVPAPDFEWYKDDTRSRRINSAQGLEIRN 276

  Fly   299 GNKYNISEEVINIYTWHLNLTIRHLTKSDFGTYSCSSVNALGKSESLIRLQELRLPPKLTTTPTP 363
            ....::             |.:.::|:..:|.|:|.:.|.||.:.:.:.|.:       ..:||.
 Frog   277 TGSRSV-------------LMVANVTEEHYGNYTCVAANKLGITNTSLYLYK-------RVSPTK 321

  Fly   364 HMQTTGKSRRKH 375
            .|..:.:....|
 Frog   322 PMSASERGSNVH 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-lambdaNP_001334747.1 None
lsampXP_031751462.1 Ig 38..128 CDD:416386 27/92 (29%)
FR1 38..54 CDD:409353 4/15 (27%)
Ig strand A' 39..45 CDD:409353 3/5 (60%)
Ig strand B 47..55 CDD:409353 1/7 (14%)
CDR1 55..59 CDD:409353 1/3 (33%)
FR2 60..67 CDD:409353 4/9 (44%)
Ig strand C 60..66 CDD:409353 4/8 (50%)
CDR2 68..78 CDD:409353 1/9 (11%)
Ig strand C' 70..73 CDD:409353 1/2 (50%)
Ig strand C' 75..78 CDD:409353 0/2 (0%)
FR3 79..114 CDD:409353 11/34 (32%)
Ig strand D 83..90 CDD:409353 1/6 (17%)
Ig strand E 93..99 CDD:409353 1/5 (20%)
Ig strand F 106..114 CDD:409353 3/7 (43%)
CDR3 115..119 CDD:409353 1/3 (33%)
Ig strand G 119..128 CDD:409353 3/8 (38%)
FR4 121..128 CDD:409353 2/6 (33%)
Ig_3 131..206 CDD:404760 28/87 (32%)
Ig strand A' 138..143 CDD:409353 1/4 (25%)
Ig strand B 149..156 CDD:409353 3/6 (50%)
Ig strand C 162..167 CDD:409353 1/4 (25%)
Ig strand C' 173..175 CDD:409353 1/6 (17%)
Ig strand E 185..191 CDD:409353 2/5 (40%)
Ig strand F 198..205 CDD:409353 3/6 (50%)
Ig strand G 212..220 CDD:409353 2/7 (29%)
Ig_3 223..302 CDD:404760 16/92 (17%)
putative Ig strand A 224..230 CDD:409353 1/6 (17%)
Ig strand B 240..244 CDD:409353 1/3 (33%)
Ig strand C 253..257 CDD:409353 0/3 (0%)
Ig strand E 281..285 CDD:409353 1/16 (6%)
Ig strand F 295..300 CDD:409353 2/4 (50%)
Ig strand G 308..311 CDD:409353 0/2 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 58 1.000 Domainoid score I10578
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 138 1.000 Inparanoid score I4412
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 1 1.000 - - FOG0000150
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.060

Return to query results.
Submit another query.