DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG45764 and CG45770

DIOPT Version :9

Sequence 1:NP_001303581.1 Gene:CG45764 / 26067042 FlyBaseID:FBgn0267411 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_001303587.1 Gene:CG45770 / 26067048 FlyBaseID:FBgn0267417 Length:214 Species:Drosophila melanogaster


Alignment Length:214 Identity:212/214 - (99%)
Similarity:213/214 - (99%) Gaps:0/214 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSNLKQKDIKPDVAVSKSVKTSRKAIEYVKSDASDIDEDINRTEYEYASSSGFVNFLRDFKKRYG 65
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly     1 MSNLKQKDIKPDVAVSKSVKTSRKAIEYVKSDASDIDEDINRTEYEYASSSGFVNFLRDFKKRYG 65

  Fly    66 EYYSNYQIRRAAETRWNEMSFRHRCQYSAEPLDTFHVEPNSVSSLQRSIEAELRMHSEISGCDTF 130
            ||||||||||||||||||||||||||||||||||||||||.|||||||||||||:||||||||||
  Fly    66 EYYSNYQIRRAAETRWNEMSFRHRCQYSAEPLDTFHVEPNRVSSLQRSIEAELRIHSEISGCDTF 130

  Fly   131 FGACGSNSCTPRKENKCSKPRVWKSCPKPRAKSSKQRRNCAKPKPKCARPRKACPRPRNSMECGK 195
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly   131 FGACGSNSCTPRKENKCSKPRVWKSCPKPRAKSSKQRRNCAKPKPKCARPRKACPRPRNSMECGK 195

  Fly   196 PKAKPRCLKPKSSKPKCSV 214
            |||||||||||||||||||
  Fly   196 PKAKPRCLKPKSSKPKCSV 214



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448439
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.