powered by:
Protein Alignment CG31817 and Psors1c2
DIOPT Version :9
Sequence 1: | NP_723962.2 |
Gene: | CG31817 / 260659 |
FlyBaseID: | FBgn0028899 |
Length: | 2353 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_065601.2 |
Gene: | Psors1c2 / 57390 |
MGIID: | 1930025 |
Length: | 135 |
Species: | Mus musculus |
Alignment Length: | 40 |
Identity: | 16/40 - (40%) |
Similarity: | 23/40 - (57%) |
Gaps: | 7/40 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 1267 DNPFCESGGQFPRSGENPNYPKAHSARHYSKENYQPECDP 1306
|:|: .:|.|.| ||| :|.|....|.|:| :|:.||
Mouse 97 DDPW-PAGTQPP---ENP-WPPAPEMDHESQE--EPDLDP 129
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG31817 | NP_723962.2 |
None |
Psors1c2 | NP_065601.2 |
SPR1 |
23..135 |
CDD:292000 |
16/40 (40%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_2CMI8 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.