DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31817 and Psors1c2

DIOPT Version :9

Sequence 1:NP_723962.2 Gene:CG31817 / 260659 FlyBaseID:FBgn0028899 Length:2353 Species:Drosophila melanogaster
Sequence 2:NP_065601.2 Gene:Psors1c2 / 57390 MGIID:1930025 Length:135 Species:Mus musculus


Alignment Length:40 Identity:16/40 - (40%)
Similarity:23/40 - (57%) Gaps:7/40 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly  1267 DNPFCESGGQFPRSGENPNYPKAHSARHYSKENYQPECDP 1306
            |:|: .:|.|.|   ||| :|.|....|.|:|  :|:.||
Mouse    97 DDPW-PAGTQPP---ENP-WPPAPEMDHESQE--EPDLDP 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31817NP_723962.2 None
Psors1c2NP_065601.2 SPR1 23..135 CDD:292000 16/40 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CMI8
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.