DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31817 and Cited4

DIOPT Version :9

Sequence 1:NP_723962.2 Gene:CG31817 / 260659 FlyBaseID:FBgn0028899 Length:2353 Species:Drosophila melanogaster
Sequence 2:NP_062509.1 Gene:Cited4 / 56222 MGIID:1861694 Length:182 Species:Mus musculus


Alignment Length:174 Identity:36/174 - (20%)
Similarity:49/174 - (28%) Gaps:70/174 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly  1124 VSDQYCTGETTPNRGRNYEDHTQACDNPFCESGGQLPRSLENPNYPKAHSAQHYPNYKPECDPDC 1188
            :::.||..:..|        ||.         |...||:|:....|...|... |...|...|. 
Mouse     7 LAEGYCLLQVPP--------HTH---------GPHAPRTLQPYAGPGMDSGLR-PRGAPLGPPP- 52

  Fly  1189 VLTETFQKGGIAYNYECLNTQKGRENGTALNSEISKQPEHSPVENNGGIVTFQVSDQYCTGETIP 1253
                  ..|.:||.              :..|.:|.||             |.||.....|.|  
Mouse    53 ------PPGTLAYG--------------SFGSPVSFQP-------------FPVSQSPGAGST-- 82

  Fly  1254 NRARNYENHTQACDNPFCESGGQFP-----RSGENPNYPKAHSA 1292
                    |.|:...|   |.|:.|     ..|.:|..|...:|
Mouse    83 --------HLQSAATP---SPGRIPAPPAAAGGPSPLQPAPGAA 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31817NP_723962.2 None
Cited4NP_062509.1 CITED 1..182 CDD:282356 36/174 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 22..129 31/142 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CMI8
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.