DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31817 and CG7016

DIOPT Version :9

Sequence 1:NP_723962.2 Gene:CG31817 / 260659 FlyBaseID:FBgn0028899 Length:2353 Species:Drosophila melanogaster
Sequence 2:NP_651301.1 Gene:CG7016 / 42968 FlyBaseID:FBgn0039238 Length:362 Species:Drosophila melanogaster


Alignment Length:329 Identity:62/329 - (18%)
Similarity:88/329 - (26%) Gaps:109/329 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   860 NEIYQGNTINGRILQDSFNNGSSGNGPYTNMGTSRQAEYDYPKEICERKSQPYRTQKPFNEPTKF 924
            |.::..|..|.:...:....|..|.||  |.|...:..:..|     .:.||    .|...|..:
  Fly    65 NAMHNNNRFNQQPQFERLQQGRPGMGP--NRGGMHRPGFAPP-----NRQQP----TPPGWPPGW 118

  Fly   925 VTGSQGQSHYPTADYKNQSI----------NQSFNRFCLNPQCSRNTPQMEDYQQNVPTGQPKME 979
            ..|:.|..:.|..|:.....          ...:|....|....|..|....:....|       
  Fly   119 QWGAGGNQNQPGFDWVQTGFAPGWNGGGGQGPGWNGPGWNGGGGRGPPPRPGFNGGGP------- 176

  Fly   980 SPYRPVSKNTSNSERQAPNVTSQSPYCPCPSIN----DPDNEQRNGG--------KTLQDRPETY 1032
            .|.|| ..|........|......|..|.|..|    .|.....|||        ..|.|:|:..
  Fly   177 PPPRP-GWNGGGPPPPMPGWNGGGPPPPRPGWNGGGPPPPRPGWNGGMEQEWDNYPRLPDQPDPN 240

  Fly  1033 VPNERSGVQAPLQICNNSTCPYALDYFKSWNSQNDD---PNSNRAGQM-------------EIQP 1081
            .||                        .:||..|:.   |.:...|.:             .|||
  Fly   241 DPN------------------------TNWNPDNESSTTPQTPIPGPIFPTTTPKPEPTFPTIQP 281

  Fly  1082 RGNPECLDTQKERVNGTALNSESSKQSEHSP----------------------VENNRGIVTFQV 1124
            |  |....|:...:.||   :.......|:|                      :..||.|: |..
  Fly   282 R--PTAQPTKDTLIIGT---NRPPLVPPHNPDPPTPTFPTWIVPEPLPKPLDELSENRAII-FPS 340

  Fly  1125 SDQY 1128
            |.:|
  Fly   341 SSKY 344



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CMI8
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.