DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31817 and CG5225

DIOPT Version :9

Sequence 1:NP_723962.2 Gene:CG31817 / 260659 FlyBaseID:FBgn0028899 Length:2353 Species:Drosophila melanogaster
Sequence 2:NP_650587.1 Gene:CG5225 / 42053 FlyBaseID:FBgn0038468 Length:594 Species:Drosophila melanogaster


Alignment Length:281 Identity:52/281 - (18%)
Similarity:89/281 - (31%) Gaps:72/281 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   409 HRNNKGGCEDMMFRGKCGKQNIYQEDVKPY------------GQNSSNSYQTTTNEYSYCDQEDS 461
            |:.:|||.....:.....|...|     ||            |.|....|..     .|......
  Fly   294 HKGDKGGHHHHYYPPGHDKGGYY-----PYPPHGGHGGHHHPGHNYPGPYPP-----PYPPHHPH 348

  Fly   462 DTPRKRHDTQPNYNH--MNRRSHRQAKAPRRSDGNED---SFRGSFEMGNGYRYP---------- 511
            |...|.:...|.:||  .|...|.....|...:.|.:   ...|    |:|:.:|          
  Fly   349 DGGDKGYHHYPPHNHGGHNHGGHNNHHPPHNGEHNHNHPPHNHG----GHGHHHPSHNHGGQDPH 409

  Fly   512 -TTPKCIVAVTQTSTLFLEGLHGNEANYQNMSH---NYAQPRQQVQEFNQEQ-PRSKISKTGRTA 571
             |.|.             .|.|||..:.|...|   ::.||:....|.:.|| ||..:.......
  Fly   410 NTHPH-------------TGTHGNGGHSQTSHHQHPHHHQPKPTKPEGSGEQTPRDDLDLLDENV 461

  Fly   572 TSNSRLVESHEGQAQEVQSK---SAEPKNQEKQRNQESFEQTKSDKTNFQSQPLNEVEFKQQKTK 633
            .....:::.::.:...::.:   |.||.:.|.:.....:....:|         |.||..:..:.
  Fly   462 EIVENIIDENDNENNFMEGEEEMSNEPNDLETEPEDADYGLEYAD---------NTVENPESPSG 517

  Fly   634 SQIIESQEDQERLVQSSSETL 654
            ::.|: .||...:|....:.:
  Fly   518 AEEID-DEDSSYMVPEGDDAM 537



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CMI8
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.