DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31817 and CG14125

DIOPT Version :9

Sequence 1:NP_723962.2 Gene:CG31817 / 260659 FlyBaseID:FBgn0028899 Length:2353 Species:Drosophila melanogaster
Sequence 2:NP_001261731.1 Gene:CG14125 / 39359 FlyBaseID:FBgn0036232 Length:263 Species:Drosophila melanogaster


Alignment Length:271 Identity:55/271 - (20%)
Similarity:85/271 - (31%) Gaps:85/271 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   950 RFCLNPQCSRNTPQMEDYQQNVPTGQP-------------KMESPYRPVSKNTSNSERQAPNVTS 1001
            |.|:.|..|...|:..|    .||..|             ..:.|::|.:|.|........|:||
  Fly    29 RQCVKPTASPKPPEDPD----DPTDDPWDPTDDSSEDPSDSTDEPWKPTAKPTVVPTEPPSNITS 89

  Fly  1002 -QSPYCPCPSINDPDNEQRNGGKTLQDRPETYVPNERSGVQAPLQICNNSTCPYALDYFKSWNSQ 1065
             ::|..|      .:|.....|....|.|..  |.|.|        ..|.:.|         ..|
  Fly    90 TENPSEP------TENPLNPTGSPTNDEPSE--PTEES--------TENPSDP---------TGQ 129

  Fly  1066 NDDPNSNRAGQMEIQPRGNPECLDTQKERVNGTALNSESSKQSEHSPVENNRGIVTFQVSDQYCT 1130
            .....||.:.|....|.|.|....|::.::......:|.:..|...|                 |
  Fly   130 PTGETSNPSDQPTDSPTGQPTQETTEETKIPAGETTNEGTSDSTEEP-----------------T 177

  Fly  1131 GE-TTPNRGRNYEDHTQACDNPFCESGGQLPRSLENPNYPKAHSAQHYPNYKPECDPDCVLTETF 1194
            || :.|    .:|..         ||.|       :|:.|.:.:.|..||.  :.:..|...:..
  Fly   178 GEPSIP----THEPE---------ESSG-------DPSDPTSATTQTIPNV--DANASCRAHQGV 220

  Fly  1195 QKGGIAYNYEC 1205
            |  .:.:.|:|
  Fly   221 Q--FLPHPYDC 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31817NP_723962.2 None
CG14125NP_001261731.1 ChtBD2 217..259 CDD:214696 3/15 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CMI8
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.