DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31817 and C54D2.1

DIOPT Version :9

Sequence 1:NP_723962.2 Gene:CG31817 / 260659 FlyBaseID:FBgn0028899 Length:2353 Species:Drosophila melanogaster
Sequence 2:NP_001360717.1 Gene:C54D2.1 / 183776 WormBaseID:WBGene00016915 Length:388 Species:Caenorhabditis elegans


Alignment Length:282 Identity:53/282 - (18%)
Similarity:82/282 - (29%) Gaps:70/282 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   896 AEYDYPKEICERKSQPYRTQKPFNEPTKFVTGSQGQSHYPTADY-KNQSINQSFNRFCLNPQCSR 959
            |..|.|....|..:.|.|.   |:.|:         ..|| .|| :..:|......||:|..|..
 Worm   148 APTDLPTPAPEATTTPRRL---FDSPS---------IAYP-GDYCETTNIICVGGSFCVNNVCVC 199

  Fly   960 NTPQMEDYQQNVP-----------TGQPKMESPYRPVSKNTSNSERQAPNVTSQSPYCPCPSIND 1013
            ...::.:.:|.||           |..|.......|.: .|:.:|......|:.:...|.|:   
 Worm   200 REGEIIENRQCVPVATTTTTTTTTTAAPTTVITTEPTT-TTTTTEPTTTTTTTTTTTTPAPT--- 260

  Fly  1014 PDNEQRNGGKTLQDRPETYVPNE-----RSGVQAPLQICNNSTCPYALDYFKSWNSQNDDPNSNR 1073
              ........|.....:|....|     .:..:||....:.:|.|              .|.:..
 Worm   261 --TASTTTTTTTTTEAQTTTTTELATTTTTTTEAPTTTFSTTTTP--------------APTTTF 309

  Fly  1074 AGQMEIQP-RGNPECLDTQKERVNGTALNSESSKQSEHSPVENNRG---IVTFQVSDQYCTGETT 1134
            .....:.| |..|.|          |..|...      :|:...:|   .:.|.:..|.|.....
 Worm   310 IIPTTVAPSREEPGC----------TPYNCAC------NPMGCGQGQIVRINFVIPGQQCNSNNQ 358

  Fly  1135 PNRGRNYEDHTQACDNPFCESG 1156
            ...|......|..|.|.|.:.|
 Worm   359 CLAGSYCNSGTCRCANSFEQRG 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31817NP_723962.2 None
C54D2.1NP_001360717.1 EB <171..210 CDD:366756 9/48 (19%)
EB 336..383 CDD:366756 10/45 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CMI8
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.