DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB2 and SCARF2

DIOPT Version :9

Sequence 1:NP_723857.1 Gene:NimB2 / 260645 FlyBaseID:FBgn0028543 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_699165.3 Gene:SCARF2 / 91179 HGNCID:19869 Length:871 Species:Homo sapiens


Alignment Length:389 Identity:84/389 - (21%)
Similarity:117/389 - (30%) Gaps:159/389 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 SRIQVCCDGYERNPHIYRRCEPICADDCRNGICTAPNTC----VCI-PGHVRTAEG----KCIST 217
            |::..||.|:.:.           .|:|...:|...:||    ||: ||..|...|    .|.:.
Human    59 SQVPTCCAGWRQQ-----------GDECGIAVCEGNSTCSENEVCVRPGECRCRHGYFGANCDTK 112

  Fly   218 CP-----------------------------------------LGCGNGVCDERN-ECKCREG-Y 239
            ||                                         ..|.:|.|..|: .|:|..| :
Human   113 CPRQFWGPDCKELCSCHPHGQCEDVTGQCTCHARRWGARCEHACQCQHGTCHPRSGACRCEPGWW 177

  Fly   240 SLEPETRKYCQ--PECKPGCSFGRCV---------APNKCACLDGYRLAADGSCE-------PVC 286
            ..:..:..||.  ..|.|  ..|.|:         ..|:|||.........|.|:       ..|
Human   178 GAQCASACYCSATSRCDP--QTGACLCHAGWWGRSCNNQCACNSSPCEQQSGRCQCRERTFGARC 240

  Fly   287 D---SCENGKC-TAPGHCNCNAGYLKLQGRCEPICSIPC-----------KNGRCIGPDICECAS 336
            |   .|..|:| ...|.|.|..||   :|:   .|..||           :.|:|.|...|..|.
Human   241 DRYCQCFRGRCHPVDGTCACEPGY---RGK---YCREPCPAGFYGLGCRRRCGQCKGQQPCTVAE 299

  Fly   337 GFEWDRKSAECLP-----KCDLPCLNGV-----------CVGNNQCD--------CKTGYVRDEH 377
            |     :...|.|     |||.||..|.           |...:.|:        |..|::.|. 
Human   300 G-----RCLTCEPGWNGTKCDQPCATGFYGEGCSHRCPPCRDGHACNHVTGKCTRCNAGWIGDR- 358

  Fly   378 QRNICQPHCPQG------------CQNGYCS-APNFCICRPGF--------IKSGIKGRQTCQA 420
                |:..|..|            |.:|:|. ....|:|.||.        ...|:.|....||
Human   359 ----CETKCSNGTYGEDCAFVCADCGSGHCDFQSGRCLCSPGVHGPHCNVTCPPGLHGADCAQA 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB2NP_723857.1 None
SCARF2NP_699165.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
PHA03247 <534..871 CDD:223021
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 570..871
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.