DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB2 and MEGF11

DIOPT Version :9

Sequence 1:NP_723857.1 Gene:NimB2 / 260645 FlyBaseID:FBgn0028543 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_001371957.1 Gene:MEGF11 / 84465 HGNCID:29635 Length:1140 Species:Homo sapiens


Alignment Length:364 Identity:94/364 - (25%)
Similarity:120/364 - (32%) Gaps:139/364 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 CCDGYERNPHIYRRCEPICADDCRNGICTAPNTCVCIPG-----------------HVRTAEGKC 214
            ||.||..:...   |.|:|.::|.:|.|.:|:||.|.||                 |       |
Human    88 CCPGYYESGDF---CIPLCTEECVHGRCVSPDTCHCEPGWGGPDCSSGCDSDHWGPH-------C 142

  Fly   215 ISTCPLGCGNGV-------------------CDE-----------RNECKCREGYSLEPE----- 244
            .:.|.  |.||.                   |:|           :..|:||.|.|.:|.     
Human   143 SNRCQ--CQNGALCNPITGACVCAAGFRGWRCEELCAPGTHGKGCQLPCQCRHGASCDPRAGECL 205

  Fly   245 -----TRKYCQPECKPG-----CSFGRCVAPN---------KCACLDGYRLAA----------DG 280
                 |..||:..|.||     |.. ||...|         :|||..|:..|.          ..
Human   206 CAPGYTGVYCEELCPPGSHGAHCEL-RCPCQNGGTCHHITGECACPPGWTGAVCAQPCPPGTFGQ 269

  Fly   281 SCEPVCDSCENGKCT-APGHCNCNAGYLKLQGRCEPICSI-----------PCKNGRCIGP--DI 331
            :|...|.....|:|. ..|.|:|.|||  :..||:..|..           .|.||....|  ..
Human   270 NCSQDCPCHHGGQCDHVTGQCHCTAGY--MGDRCQEECPFGSFGFQCSQHCDCHNGGQCSPTTGA 332

  Fly   332 CECASGFEWDRKSAECLPK------CDLPCLNGVCVGNNQCDCK--TGYVRDEHQRNICQP---- 384
            |||..|::..|......|:      |.|||   .|..:|...|.  ||..       .|||    
Human   333 CECEPGYKGPRCQERLCPEGLHGPGCTLPC---PCDADNTISCHPVTGAC-------TCQPGWSG 387

  Fly   385 -HCPQGCQNGY----CSAPNFCICRPGFIKSGIKGRQTC 418
             ||.:.|..||    |..|  |.|:.|.....|.|..||
Human   388 HHCNESCPVGYYGDGCQLP--CTCQNGADCHSITGGCTC 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB2NP_723857.1 None
MEGF11NP_001371957.1 EMI 26..93 CDD:400092 3/4 (75%)
EGF_CA 275..320 CDD:419698 12/46 (26%)
EGF_CA 362..409 CDD:419698 17/58 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.