DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB2 and Esm1

DIOPT Version :9

Sequence 1:NP_723857.1 Gene:NimB2 / 260645 FlyBaseID:FBgn0028543 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_076101.1 Gene:Esm1 / 71690 MGIID:1918940 Length:184 Species:Mus musculus


Alignment Length:153 Identity:38/153 - (24%)
Similarity:48/153 - (31%) Gaps:62/153 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 CDGYERNPHIYRRCEPICADDCRNGICTAPNTCVCIPGHV--RTAEGKCISTCPLGCGNGVCDER 230
            ||..|....:  ||:....|||  |.|   ..|...||..  ||..|    ...:.||.|:    
Mouse    32 CDKTECRSSL--RCKRTVLDDC--GCC---QVCAAGPGETCYRTVSG----MDGVKCGPGL---- 81

  Fly   231 NECKCREGYSLEPETRKYCQPECKPGCSFGRCVAPNKCACLDGYRLAADGSCEPVCDSCENG--- 292
               || ..||.|.:.          |..||                        :|..|..|   
Mouse    82 ---KC-HFYSEEDDF----------GDEFG------------------------ICKDCPYGTFG 108

  Fly   293 -KCTAPGHCNCNAGYL-KLQGRC 313
             :|...  |||.:|.. ::.|||
Mouse   109 MECKET--CNCQSGICDRVTGRC 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB2NP_723857.1 None
Esm1NP_076101.1 IGFBP 28..83 CDD:278641 19/68 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 145..184
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.