DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB2 and Megf11

DIOPT Version :9

Sequence 1:NP_723857.1 Gene:NimB2 / 260645 FlyBaseID:FBgn0028543 Length:421 Species:Drosophila melanogaster
Sequence 2:XP_038938374.1 Gene:Megf11 / 691517 RGDID:1582797 Length:1139 Species:Rattus norvegicus


Alignment Length:361 Identity:96/361 - (26%)
Similarity:119/361 - (32%) Gaps:138/361 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 CCDGYERNPHIYRRCEPICADDCRNGICTAPNTCVCIPG-----------------HVRT----- 209
            ||.||..|...   |.|:|.::|.:|.|.:|:||.|.||                 |...     
  Rat    88 CCPGYYENGDF---CIPLCTEECMHGRCVSPDTCHCEPGWGGPDCSSGCDSEHWGPHCSNRCQCQ 149

  Fly   210 --------------AEG----KCISTCPLG-----------CGNGV-CDER-NECKCREGYSLEP 243
                          |.|    :|...|..|           |.:|. ||.| .||.|..||    
  Rat   150 NGALCNPITGACVCAPGFRGWRCEEFCAPGTHGKGCQLLCQCHHGASCDPRTGECLCAPGY---- 210

  Fly   244 ETRKYCQPECKPG-----CSFGRCVAPN---------KCACLDGYRLAA----------DGSCEP 284
             |..||:..|.||     |.. ||...|         :|||..|:..|.          ..:|..
  Rat   211 -TGVYCEELCPPGSHGAHCEL-RCPCQNGGTCHHITGECACPPGWTGAVCAQPCPPGTFGQNCSQ 273

  Fly   285 VCDSCENGKCT-APGHCNCNAGYLKLQGRCEPICSI-----------PCKNGRCIGP--DICECA 335
            .|.....|:|. ..|.|:|.|||  :..||:..|..           .|.||....|  ..|||.
  Rat   274 DCPCHHGGQCDHVTGQCHCTAGY--MGDRCQEECPFGTFGFRCSQRCDCHNGGQCSPATGACECE 336

  Fly   336 SGFE----WDRKSAECL--PKCDLPCLNGVCVGNN---------QCDCKTGYVRDEHQRNICQPH 385
            .|::    .:|...|.|  |.|..||   .|...|         .|.|:.|:     ..:.|...
  Rat   337 PGYKGPSCQERLCPEGLHGPGCTSPC---PCDTENTISCHPVTGACTCQPGW-----SGHYCNES 393

  Fly   386 CPQG-----------CQNGY-C-SAPNFCICRPGFI 408
            ||.|           ||||. | |....|.|.|||:
  Rat   394 CPAGYYGNGCQLPCTCQNGADCHSITGSCTCAPGFM 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB2NP_723857.1 None
Megf11XP_038938374.1 EMI 26..93 CDD:400092 3/4 (75%)
EGF_CA 189..234 CDD:419698 19/50 (38%)
Laminin_EGF 275..320 CDD:395007 12/46 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.