DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB2 and megf11

DIOPT Version :9

Sequence 1:NP_723857.1 Gene:NimB2 / 260645 FlyBaseID:FBgn0028543 Length:421 Species:Drosophila melanogaster
Sequence 2:XP_009291879.1 Gene:megf11 / 563468 ZFINID:ZDB-GENE-060503-252 Length:1114 Species:Danio rerio


Alignment Length:373 Identity:94/373 - (25%)
Similarity:124/373 - (33%) Gaps:144/373 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 CCDGYERNPHIYRRCEPICADDCRNGICTAPNTCVCIPGHVRTAEG--KCISTCPLGCGNGVCDE 229
            ||.||..:..:   |.|.|:::|.:|.|.:|:||.|.||.     |  .|.|.|..|.....|. 
Zfish    94 CCPGYFESGDL---CVPRCSEECAHGRCVSPDTCQCEPGW-----GGLDCSSGCESGYWGPHCS- 149

  Fly   230 RNECKCREGYSLEPETRK----------YCQPECKP-----GCSFGRCVAPN---------KCAC 270
             |.|:|:.|....|.|..          .|:..|:|     ||.. :|...|         :|.|
Zfish   150 -NRCQCKNGALCNPITGACVCTDGYQGWRCEDLCEPGYYGKGCQL-QCQCLNGATCHHETGECIC 212

  Fly   271 LDGY------RLAADGSCEPVCDS---CEN-GKC-TAPGHCNCNAGYL-----------KLQGRC 313
            ..||      .....||..|.|:.   |:| |.| ...|.|:|.||:.           |....|
Zfish   213 APGYMGPICGERCPSGSHGPQCEQRCPCQNGGTCHHITGECSCPAGWTGSVCAQPCPFGKYGINC 277

  Fly   314 EPICSIPCKNG----RCIGPDICECASGFEWDRKSAECL-----PKCDLPC----------LNGV 359
            ...||  |:||    ...|.  |:|.:|:...|...||.     |:|.|.|          :||.
Zfish   278 SKECS--CRNGGLCDHITGQ--CQCMAGYSGHRCQEECPVGTYGPQCTLHCDCQNGAKCYHINGA 338

  Fly   360 CVGNNQCDCKTGYVRDEHQRNICQP-------------------------------------HCP 387
            |:      |.||:.....|...|.|                                     :|.
Zfish   339 CL------CDTGFKGHHCQDRFCPPGLYGLICDKYCPCNSTNTISCHPLTGECSCTAGWTGLYCN 397

  Fly   388 QGCQNGY----CSAP-------------NFCICRPGFIKSGIKGRQTC 418
            :.|..||    |..|             ..|||.||:  :|....|||
Zfish   398 ETCPPGYYGEGCGVPCQCANGADCHSLTGACICAPGY--TGDDCSQTC 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB2NP_723857.1 None
megf11XP_009291879.1 EMI 32..98 CDD:311482 2/3 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.