DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB2 and Dkk3

DIOPT Version :9

Sequence 1:NP_723857.1 Gene:NimB2 / 260645 FlyBaseID:FBgn0028543 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_001347186.1 Gene:Dkk3 / 50781 MGIID:1354952 Length:366 Species:Mus musculus


Alignment Length:329 Identity:70/329 - (21%)
Similarity:111/329 - (33%) Gaps:125/329 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 QVLDETALFINKTRSAM-------ASGVCYKEVPTASLLRN-----SRDQFVGNGTTPDMSRIQV 166
            :::::|.   :|.|||:       |:.....||..|||..|     |.:..|||.|.        
Mouse    73 ELMEDTQ---HKLRSAVEEMEAEEAAAKTSSEVNLASLPPNYHNETSTETRVGNNTV-------- 126

  Fly   167 CCDGYERNPHIYRRCEPICADDCRNGICTAPNTCVCIPGHVRTAEGKCISTCPLGCGNGVCDERN 231
                     |:::....|..:  ::|......|.:...|   ..|||....|       :.||  
Mouse   127 ---------HVHQEVHKITNN--QSGQVVFSETVITSVG---DEEGKRSHEC-------IIDE-- 168

  Fly   232 ECKCREGYSLEPETRKYCQ-----PECKPGCSFGR--CVAPNKCACLDGYRLAADGSCE------ 283
            :|          ...:|||     ..|:| |...:  |...::|.   |.:|.|.|.|.      
Mouse   169 DC----------GPTRYCQFSSFKYTCQP-CRDQQMLCTRDSECC---GDQLCAWGHCTQKATKG 219

  Fly   284 ---PVCDS---CENGKCTAPGHCNCNAGYLKLQGRCEPICS-IPCKNGRCIGPDICECASGFEWD 341
               .:||:   |:.|.|     |....|.|      .|:|: :|.:...|..| ..:......|:
Mouse   220 GNGTICDNQRDCQPGLC-----CAFQRGLL------FPVCTPLPVEGELCHDP-TSQLLDLITWE 272

  Fly   342 RKSAECLPKCDLPCLNGVCVGNNQCDCKTGYVRDEHQRNICQPHCPQGCQNGYCSAPNFCICRPG 406
            .:....|.:|  ||.:|:                     :||||          |.....:|:|.
Mouse   273 LEPEGALDRC--PCASGL---------------------LCQPH----------SHSLVYMCKPA 304

  Fly   407 FIKS 410
            |:.|
Mouse   305 FVGS 308



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.