DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB2 and Dkk4

DIOPT Version :9

Sequence 1:NP_723857.1 Gene:NimB2 / 260645 FlyBaseID:FBgn0028543 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_001102802.1 Gene:Dkk4 / 502097 RGDID:1563172 Length:221 Species:Rattus norvegicus


Alignment Length:224 Identity:50/224 - (22%)
Similarity:66/224 - (29%) Gaps:92/224 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 CADDCRNGICTAPNTCVCIPGHVRTAEGKCISTCPLGCGNGVCD---------ERN----ECKCR 236
            || .||........:.:|.||.|              |.|.||.         :||    :....
  Rat    63 CA-TCRRVRRRCQRSAMCCPGTV--------------CVNDVCTAVENTRPVMDRNTDGQDGTYA 112

  Fly   237 EGYSLEP--ETRKYCQPECKPGCSFGRCVAPNKCACLDGYRLAADGSCEPVCDSCENGKCTAPGH 299
            ||.:..|  |.|...:|..|...|       ||         ..:|      :||.......||.
  Rat   113 EGTTKWPAEENRPQGKPSTKKSQS-------NK---------GQEG------ESCLRTSDCGPGL 155

  Fly   300 CNCNAGYLKLQGRCEP------ICSIPCKNGRCIGPDI---CECASGFEWDRKSAECLPKCDLPC 355
            |.....:.|:   |:|      :||..........|:|   |:|..|               |.|
  Rat   156 CCARHFWTKI---CKPVLLEGQVCSRRGHKDTAQAPEIFQRCDCGPG---------------LSC 202

  Fly   356 LNGVCVGNNQCDCKTGYVRDEHQR-NICQ 383
            .:.| .||.|           |.| .:||
  Rat   203 RSQV-TGNRQ-----------HTRLRVCQ 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB2NP_723857.1 None
Dkk4NP_001102802.1 Dickkopf_N 41..91 CDD:282549 11/42 (26%)
Prokineticin <145..202 CDD:148298 15/74 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.