DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB2 and eater

DIOPT Version :9

Sequence 1:NP_723857.1 Gene:NimB2 / 260645 FlyBaseID:FBgn0028543 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_651533.3 Gene:eater / 43262 FlyBaseID:FBgn0243514 Length:1074 Species:Drosophila melanogaster


Alignment Length:285 Identity:112/285 - (39%)
Similarity:150/285 - (52%) Gaps:34/285 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 KTRSAMASGVCYKEVPTASLLRNSRDQFVGNGTTPDMSRIQVCCDGYERNPHIYRRCEPICADDC 189
            |.::..::|||                     ..||...   |...||::  |...|.|||.:.|
  Fly   199 KCKNGCSNGVC---------------------RAPDKCE---CNKFYEKD--IDGNCVPICENGC 237

  Fly   190 RNGICTAPNTCVCIPGHVRTAEGKCISTCPLGCGNGVCDERNECKCREGYSLEPETRKYCQPECK 254
            .||.||||:.|.|:.|:.:.....|::.||.||.||||...|||.|..||:   :....|.|.||
  Fly   238 VNGNCTAPDVCQCLTGYTKIGHNVCLAVCPEGCQNGVCVAPNECSCNAGYT---KLEGVCTPVCK 299

  Fly   255 PGCSFGRCVAPNKCACLDGYRLAADGSCEPVCD-SCENGKCTAPGHCNCNAGYLKLQGR-CEPIC 317
            .||..|.|.:|.||:|.|||.:.::..|.|||. .|:||.|.|||.|:|:.||:|..|. |:|||
  Fly   300 DGCVNGFCASPEKCSCNDGYEMDSENRCSPVCSGGCKNGFCVAPGKCSCDEGYIKGTGNSCKPIC 364

  Fly   318 SIPCKNGRCIGPDICECASGFEWDRKSAECLPKCDLPCLNGVCVGNNQCDCKTGYVRDEHQRNIC 382
            |..|:||.|..|:.|.|..|:|.|.:: .|.|.|...|.||.||...:|.|..||.::  ..|.|
  Fly   365 SKGCENGFCDAPEKCSCNDGYEMDGEN-RCSPVCSGGCKNGFCVAPGKCSCDEGYSKE--TGNSC 426

  Fly   383 QPHCPQGCQNGYCSAPNFCICRPGF 407
            :|.|.:||:||:|.||..|.|..|:
  Fly   427 KPICSKGCENGFCDAPEKCSCNDGY 451



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D16493at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24047
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.