DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB2 and NimC1

DIOPT Version :9

Sequence 1:NP_723857.1 Gene:NimB2 / 260645 FlyBaseID:FBgn0028543 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_001260453.1 Gene:NimC1 / 34816 FlyBaseID:FBgn0259896 Length:622 Species:Drosophila melanogaster


Alignment Length:411 Identity:121/411 - (29%)
Similarity:157/411 - (38%) Gaps:135/411 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 YGHYVQPVTPPAHRVQVLDETALFINKTRSAMASGVCYKEVPTASLLRNSRDQFVGNGTTPDMSR 163
            |.::...||...|:....||||               |:.|...|                    
  Fly    54 YSYFHGWVTKYRHQYVYEDETA---------------YRTVMRPS-------------------- 83

  Fly   164 IQVCCDGYERNPHIYRRCEPICADDC-RNGICTAPNTCVCIPGHVRTAEG--KCISTCPLGCG-N 224
               ||:|||.:   ...|:|:|...| ::|.|::||||.|..|:     |  .|...||..|| |
  Fly    84 ---CCEGYEGS---VENCKPVCRQQCPQHGFCSSPNTCSCNAGY-----GGIDCHPVCPTVCGKN 137

  Fly   225 GVCDERNECKCREGY-------SLEPETRKYC-------QP---ECKPG---------------- 256
            ..||....|.|:.||       :..|...|.|       :|   ||:||                
  Fly   138 EFCDRPGVCSCQNGYKRTSPSDNCLPVCEKECGHHSFCSEPGKCECEPGYEKVGNGTVFPDGYKN 202

  Fly   257 -----CS---------FGRCVAPNKCACLDGYRLAADG--SCEPVCDSC-ENGKCTAPGHCNCNA 304
                 ||         ..|||.|..|.|.:|| ...||  :|.|||.:| |||.|.:||.|.|..
  Fly   203 NSNGNCSPICPKDCGQNSRCVRPGVCECENGY-AGDDGGTNCRPVCSTCPENGLCLSPGVCVCKP 266

  Fly   305 GYLKLQGRCEPICSIPCKNGRCIGPDICECASGFEWDRKSAECLPKCDLPCLNGVC--------- 360
            ||:.....|:|.|.....|..|:.|:.|||..|:|......:|:|||...|.||.|         
  Fly   267 GYVMRNDLCQPHCEKCSDNAHCVAPNQCECFPGYESSGADKKCVPKCSKGCTNGFCFAPETCVCS 331

  Fly   361 ----VGNNQ--------------------CDCKTGYVRDEHQRNICQPHCPQGCQNGYCSAPNFC 401
                :|.||                    |.|..||...::..:.|.|.|..||.||:|.|||||
  Fly   332 IGYQMGPNQVCEPKCSLNCVHGKCTSPETCTCDPGYRFKDNSHHECDPICDSGCSNGHCVAPNFC 396

  Fly   402 ICRPGF-IKSGIKGRQTCQAV 421
            ||..|: :.|.......||.:
  Fly   397 ICHDGYQLNSTNPVTSMCQPI 417



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D16493at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24047
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.