DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB2 and CG11674

DIOPT Version :9

Sequence 1:NP_723857.1 Gene:NimB2 / 260645 FlyBaseID:FBgn0028543 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_572948.1 Gene:CG11674 / 32374 FlyBaseID:FBgn0030551 Length:344 Species:Drosophila melanogaster


Alignment Length:340 Identity:77/340 - (22%)
Similarity:119/340 - (35%) Gaps:102/340 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 FVGNGTTPDMSRIQVC-----CDGYERNPHIYRRCEPICADDCRNGICTAPNT---CVCIPGHVR 208
            |:..|...|:..:. |     |..:||.     ||..:..      ||||..:   ..|.|...|
  Fly    15 FLATGRAEDLLELS-CSSDAQCAQFERG-----RCVDMAC------ICTARGSGERVPCTPLEER 67

  Fly   209 TAEGKCI-STCPLGCGNGVCDER-NECKCREGYSLEPETRKYCQP-------------ECKPGCS 258
            ......| ..||....|.:|..| .:|.|.||: :..:.|:.|.|             :|:....
  Fly    68 LKLTNIIGGACPCPMPNAICHTRWQQCHCSEGH-VSSDDRRRCLPAVVPVGGSCEFQQQCQRADR 131

  Fly   259 FGRCVAPNKCACLDGYRLAADGSCEPV----------CDSCENGKC-TAPGHCNCNAGYLK---- 308
            |..|:. |:|.||:.:.. .:|.|..|          |.||....| |....|.|:..::.    
  Fly   132 FSSCIG-NQCLCLNQFEF-HEGRCLSVLQSSCLEDKDCGSCGASICLTKTKRCGCSKNFVHNHNM 194

  Fly   309 ---LQG-----RCEPICSIPCK-----NGRCIGPDICECASGFEWDRKSAECLPK---CDLPCLN 357
               ::|     .||.  |.|||     :|||: ..:|.|.| ..:.::.|..:.|   .||..:|
  Fly   195 TKCIKGSAYGDTCEH--SSPCKLNLGADGRCL-DHLCVCRS-THYPKRVANEVAKDENDDLDAVN 255

  Fly   358 --------------GVCVGNNQCDCKTGYVRDEHQRNICQPHCPQGCQNGYCSA-------PNFC 401
                          .:|..:::|..:.   .|:........| |..|..|.||.       .|.|
  Fly   256 NLERITCAPIVPFGALCRNDSECRMQP---MDQENATASIGH-PMVCNWGECSCSKTHRLEDNKC 316

  Fly   402 ICRPGFIKSGIKGRQ 416
            :    |:::.....|
  Fly   317 V----FVENSATNYQ 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB2NP_723857.1 None
CG11674NP_572948.1 EB 96..153 CDD:279949 14/59 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.