DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB2 and Ccbe1

DIOPT Version :9

Sequence 1:NP_723857.1 Gene:NimB2 / 260645 FlyBaseID:FBgn0028543 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_848908.1 Gene:Ccbe1 / 320924 MGIID:2445053 Length:408 Species:Mus musculus


Alignment Length:175 Identity:42/175 - (24%)
Similarity:66/175 - (37%) Gaps:56/175 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   239 YSLEPETRKYCQPECKPGCSFGRCVAPNKCACLDGYRLAADGSCEPVCDSCENGKCTAPGHCNCN 303
            |..|||.|.      :..||..: :...|..||.                 .:|:.|......|.
Mouse    36 YREEPEDRD------REVCSENK-ITTTKYPCLK-----------------SSGELTTCFRKKCC 76

  Fly   304 AGYLKLQGRCEP----ICS-IPCKNGRC---IGPDICECASGFEWDRKSAE------CL------ 348
            .||..:.|:|.|    ||: .||:. :|   .|..:|.|..|:.:||:..:      ||      
Mouse    77 KGYKFVLGQCIPEDYDICAQAPCEQ-QCTDNFGRVLCTCYPGYRYDRERHQKRERPYCLDIDECA 140

  Fly   349 ----PKCDLPCLNGVCVGNNQCDCKTGYVRDEHQRNICQPHCPQG 389
                ..|...|:|  .:|:..|:|:.||:.::..|.     |.:|
Mouse   141 TSNTTLCAHICIN--TMGSYHCECREGYILEDDGRT-----CTRG 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB2NP_723857.1 None
Ccbe1NP_848908.1 EGF_CA 135..176 CDD:214542 9/47 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 246..335
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 361..408
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.