DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB2 and NimA

DIOPT Version :9

Sequence 1:NP_723857.1 Gene:NimB2 / 260645 FlyBaseID:FBgn0028543 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_001285918.1 Gene:NimA / 318930 FlyBaseID:FBgn0261514 Length:565 Species:Drosophila melanogaster


Alignment Length:372 Identity:78/372 - (20%)
Similarity:110/372 - (29%) Gaps:167/372 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VLLAICSLGQGQFKTAGIKT--RQPPSGNLQLAGNSSESGWRSYNQSSYGWSTQNQSNYAWNQQN 75
            :|..:..||.||..|..|.|  :...:|.:.|.                  |.|...|....::.
  Fly    13 LLAMVLPLGSGQNSTLKINTNVKDIEAGVVALP------------------SIQGPGNICIREEP 59

  Fly    76 HVEQGSAGFVRAEVFQPV---------TLPPLYGHYVQPVTPPAHRVQVLDETALFINKTRSAMA 131
            :||.     |:....|||         .:||....:...:. ...|||.|       ||||:   
  Fly    60 YVEH-----VQVPEMQPVRVRTSSWCMEIPPRCATFKTEMR-EVMRVQKL-------NKTRT--- 108

  Fly   132 SGVCYKEVPTASLLRNSRDQFVGNGTTPDMSRIQVCCDGYERNPHIYRRCEPICADDCRNGICTA 196
                                            ::.||.|||                        
  Fly   109 --------------------------------VRFCCQGYE------------------------ 117

  Fly   197 PNTCVCIPGHVRTAEGKCISTCPLGCGNGVCDERNECKCREGYSLEPETRKYCQPECKPGCSFGR 261
                    |::..::..|...|..|||.|.|...:.|.|.|||     ..|:|...|        
  Fly   118 --------GNLSDSQATCKPICRGGCGRGSCVMPDICSCEEGY-----IGKHCTQRC-------- 161

  Fly   262 CVAPNKCACLDGYRLAADGSCEPVCDSCENGKC--TAPGHCNCNAGYLKLQGRCEPICSIPCKNG 324
                      |..|...|  |:.:| .|:||..  ...|.|:|.||:   .|:   .|.:||..|
  Fly   162 ----------DHDRWGLD--CKNLC-QCQNGAACDNKSGLCHCIAGW---TGQ---FCELPCPQG 207

  Fly   325 ----RCIGPDICECASGFEWDRKSAECLPKCDLPC--LNGVCVGNNQ 365
                .|               ||:.:|..|   ||  ..|.|:..:|
  Fly   208 TYGIMC---------------RKACDCDEK---PCNPQTGACIQQDQ 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB2NP_723857.1 None
NimANP_001285918.1 EMI 52..116 CDD:284877 19/111 (17%)
EGF_2 170..200 CDD:285248 11/36 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.