DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB2 and shf

DIOPT Version :9

Sequence 1:NP_723857.1 Gene:NimB2 / 260645 FlyBaseID:FBgn0028543 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_001284963.1 Gene:shf / 31617 FlyBaseID:FBgn0003390 Length:460 Species:Drosophila melanogaster


Alignment Length:205 Identity:74/205 - (36%)
Similarity:94/205 - (45%) Gaps:49/205 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   218 CPLGCG-NGVCDERNECKCREGYSLEPETRKYCQPECKPGCSFGRCVAPNKCACLDGYRLAADGS 281
            |.|.|| ||.|:|.:.|||..||:.:.....:|.|:|..|   |.|.||:.|.|.:||:   ...
  Fly   287 CSLKCGKNGYCNEHHICKCNVGYTGQYCETAFCFPQCLNG---GNCTAPSVCTCPEGYQ---GTQ 345

  Fly   282 CE-PVC-DSCEN-GKCTAPGHCNCNAGYLKLQGRCE-PICSIPCKN-GRCIGPDICECASGFEWD 341
            || .:| |.|.| |||.....|.|:.||..|  ||| ..|.||||| |||||.::|.|.:|...|
  Fly   346 CEGGICKDKCLNGGKCIQKDKCQCSKGYYGL--RCEYSKCVIPCKNEGRCIGNNLCRCPNGLRGD 408

  Fly   342 RKSAECLPKCDLPCLNGVCVGNNQCDCKTGYVRDEHQRNICQPHCPQGCQNGYCSAPNFCICRPG 406
            .                         |:.|    ..||:||:      |:||.|.:...|.|.||
  Fly   409 H-------------------------CEIG----RKQRSICK------CRNGTCVSHKHCKCHPG 438

  Fly   407 FIKSGIKGRQ 416
            |......||:
  Fly   439 FYGRHCNGRK 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB2NP_723857.1 None
shfNP_001284963.1 WIF 137..258 CDD:280237
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.