DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB2 and Pear1

DIOPT Version :9

Sequence 1:NP_723857.1 Gene:NimB2 / 260645 FlyBaseID:FBgn0028543 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_001128431.1 Gene:Pear1 / 295293 RGDID:1305653 Length:1033 Species:Rattus norvegicus


Alignment Length:497 Identity:119/497 - (23%)
Similarity:161/497 - (32%) Gaps:211/497 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 LQLAG--NSSESG----WRSYNQSSYGWSTQNQSNYAWNQQNHVEQGSAGFVRAEVFQPVTLPPL 98
            |:|||  ||::..    |.|:..::              :::|:             :|.:|||.
  Rat    13 LRLAGTLNSNDPNVCTFWESFTTTT--------------KESHL-------------RPFSLPPA 50

  Fly    99 YGHYVQPVTPPAHRVQVLDETALFINKTRSAMASGVCYKEVPTASLLRNSRDQFVGNGTTPDMSR 163
            .. ..:|...|....|.:                 |.|:.|....:..:||            .|
  Rat    51 ES-CDRPWEDPHTCAQPM-----------------VVYRTVYRQVVKMDSR------------PR 85

  Fly   164 IQVCCDGYERNPHIYRRCEPICADDCRNGICTAPNTCVCIPGHVRTAEGKCISTCPLG------- 221
            :| ||.||..:.   ..|.|:||.:|.:|.|.|||.|.|.||   .....|.|.|..|       
  Rat    86 LQ-CCGGYYESS---GACVPLCAQECVHGRCVAPNRCQCAPG---WRGDDCSSECAPGMWGPQCD 143

  Fly   222 ----CGN-GVCDERN-ECKCREGYSLEPETRKYCQPEC---------KPGCSFG-RCVAPNKCAC 270
                ||| ..||.|: .|.|..|  |:|       |:|         .|.|.|. .|...: |..
  Rat   144 RLCLCGNSSSCDPRSGVCFCPSG--LQP-------PDCLQPCPDGHYGPACQFDCHCYGAS-CDP 198

  Fly   271 LDGYRLAADGSCEPVCD----------------SCENGKCT--APGHCNCNAGYLKLQGRCEPIC 317
            .||......|...|.|:                .|:||...  :.|.|:|..|::.:      ||
  Rat   199 RDGACFCPPGRTGPSCNVPCSQGTDGFFCPRTYPCQNGGVPQGSQGSCSCPPGWMGV------IC 257

  Fly   318 SIPCKNG----------RCIGPDICE-------CASGFEWDRKSAE---------CLPKCDLPCL 356
            |:||..|          ||....:|:       ||.|:..||...|         |...||  |.
  Rat   258 SLPCPEGFHGPNCTQECRCHNGGLCDRFTGQCHCAPGYIGDRCREECPVGRFGQDCAETCD--CA 320

  Fly   357 NGV-CV-GNNQCDCKTGYVRD------------------------EHQRNI--------CQP--- 384
            .|. |. .|..|.|:.|:..|                        ||..:.        |||   
  Rat   321 PGARCFPANGACLCEHGFTGDRCTERLCPDGRYGLSCQDPCTCDPEHSLSCHPMHGECSCQPGWA 385

  Fly   385 ------HCPQ-----GCQ-------NGYCSAPN-FCICRPGF 407
                  .|||     |||       .|.|.|.: .|.|.||:
  Rat   386 GLHCNESCPQDTHGAGCQEHCLCLHGGVCLADSGLCRCAPGY 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB2NP_723857.1 None
Pear1NP_001128431.1 EMI 25..93 CDD:284877 20/125 (16%)
EGF_CA 535..580 CDD:304395
Laminin_EGF 620..665 CDD:278482
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.