Sequence 1: | NP_723857.1 | Gene: | NimB2 / 260645 | FlyBaseID: | FBgn0028543 | Length: | 421 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001099820.1 | Gene: | Dkk1 / 293897 | RGDID: | 1307313 | Length: | 270 | Species: | Rattus norvegicus |
Alignment Length: | 207 | Identity: | 44/207 - (21%) |
---|---|---|---|
Similarity: | 62/207 - (29%) | Gaps: | 80/207 - (38%) |
- Green bases have known domain annotations that are detailed below.
Fly 254 KPGCSFGRCVAP-------NKCACLDGYR---LAADGSC--EPVCDSCENGKCTAPGHCNCNAGY 306
Fly 307 LKLQGRCEPICSIPCKNGRCIGPDICECASGFEWDRKSAECLPKCDLPCLNGVCVGNNQCDCKTG 371
Fly 372 YVRDEHQRNICQPH--------------------------C--PQGCQNGYCSAPNFC--ICRPG 406
Fly 407 FIKSGIKGRQTC 418 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
NimB2 | NP_723857.1 | None | |||
Dkk1 | NP_001099820.1 | Dickkopf_N | 86..142 | CDD:398399 | 17/86 (20%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1218 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |