DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB2 and Scarf2

DIOPT Version :9

Sequence 1:NP_723857.1 Gene:NimB2 / 260645 FlyBaseID:FBgn0028543 Length:421 Species:Drosophila melanogaster
Sequence 2:XP_036015777.1 Gene:Scarf2 / 224024 MGIID:1858430 Length:838 Species:Mus musculus


Alignment Length:393 Identity:89/393 - (22%)
Similarity:122/393 - (31%) Gaps:160/393 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 TPDMSRIQVCCDGYERNPHIYRRCEPICADDCRNGICTAPNTC----VCI-PGHVRTAEG----K 213
            ||. |::..||.|:.:           ..|:|...:|...:||    ||: ||..|...|    .
Mouse    48 TPG-SQVLTCCAGWRQ-----------LGDECGIAVCEGNSTCSENEVCVRPGECRCRHGYFGAN 100

  Fly   214 CISTCPLGCGNGVCDERNECKCREGYSLEPET-------RKY--------------CQP-----E 252
            |.:.||.......|.||  |.|......|..|       |::              |.|     .
Mouse   101 CDTKCPRQFWGPDCKER--CSCHPHGQCEDVTGQCTCHARRWGARCEHACQCQHGTCHPRSGACR 163

  Fly   253 CKPG-----------CS--------FGRCV---------APNKCACLDGYRLAADGSCE------ 283
            |:||           ||        .|.|:         ..|:|||.........|.|:      
Mouse   164 CEPGWWGAQCASACYCSATSRCDPQTGACLCHVGWWGRSCNNQCACNSSPCEQQSGRCQCRERMF 228

  Fly   284 -PVCD---SCENGKC-TAPGHCNCNAGYLKLQGRCEPICSIPC-----------KNGRCIGPDIC 332
             ..||   .|.:|:| ...|.|.|:.||   :|:   .|..||           :.|:|.|...|
Mouse   229 GARCDRYCQCSHGRCHPVDGTCACDPGY---RGK---YCREPCPAGFYGPGCRRRCGQCKGQQPC 287

  Fly   333 ECASGFEWDRKSAECLP-----KCDLPCLNGV-----------CVGNNQCD--------CKTGYV 373
            ....|     :...|.|     |||.||..|.           |...:.|:        |..|::
Mouse   288 TVVEG-----RCLTCEPGWNGTKCDQPCATGFYGEGCGHRCPPCRDGHACNHVTGKCTHCNAGWI 347

  Fly   374 RDEHQRNICQPHCPQG------------CQNGYCS-APNFCICRPGF--------IKSGIKGRQT 417
            .|.     |:..|..|            |.:|:|. ....|:|.||.        ..:|:.|...
Mouse   348 GDR-----CETKCSNGTYGEDCAFVCSDCGSGHCDFQSGRCLCSPGVHGPHCNVTCPAGLHGVDC 407

  Fly   418 CQA 420
            .||
Mouse   408 AQA 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB2NP_723857.1 None
Scarf2XP_036015777.1 exchanger_TraA <74..431 CDD:411343 80/355 (23%)
PHA03307 526..>836 CDD:223039
PHA03247 <683..838 CDD:223021
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.