DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB2 and Megf11

DIOPT Version :9

Sequence 1:NP_723857.1 Gene:NimB2 / 260645 FlyBaseID:FBgn0028543 Length:421 Species:Drosophila melanogaster
Sequence 2:XP_006511049.1 Gene:Megf11 / 214058 MGIID:1920951 Length:1138 Species:Mus musculus


Alignment Length:361 Identity:97/361 - (26%)
Similarity:120/361 - (33%) Gaps:138/361 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 CCDGYERNPHIYRRCEPICADDCRNGICTAPNTCVCIPG-----------------HVRT----- 209
            ||.||..|...   |.|:|.::|.:|.|.:|:||.|.||                 |...     
Mouse    87 CCPGYYENGDF---CIPLCTEECMHGRCVSPDTCHCEPGWGGPDCSSGCDSEHWGPHCSNRCQCQ 148

  Fly   210 --------------AEG----KCISTCPLG-----------CGNGV-CDER-NECKCREGYSLEP 243
                          |.|    :|...|..|           |.:|. ||.| .||.|..||    
Mouse   149 NGALCNPITGACVCAPGFRGWRCEELCAPGTHGKGCQLLCQCHHGASCDPRTGECLCAPGY---- 209

  Fly   244 ETRKYCQPECKPG-----CSFGRCVAPN---------KCACLDGYRLAA----------DGSCEP 284
             |..||:..|.||     |.. ||...|         :|||..|:..|.          ..:|..
Mouse   210 -TGVYCEELCPPGSHGAHCEL-RCPCQNGGTCHHITGECACPPGWTGAVCAQPCPPGTFGQNCSQ 272

  Fly   285 VCDSCENGKCT-APGHCNCNAGYLKLQGRCEPICSI-----------PCKNGRCIGP--DICECA 335
            .|.....|:|. ..|.|:|.|||  :..||:..|..           .|.||....|  ..|||.
Mouse   273 DCPCHHGGQCDHVTGQCHCTAGY--MGDRCQEECPFGTFGFLCSQRCDCHNGGQCSPATGACECE 335

  Fly   336 SGFE----WDRKSAECL--PKCDLPCLNGVCVGNN---------QCDCKTGYVRDEHQRNICQPH 385
            .|::    .:|...|.|  |.|.|||   .|...|         .|.|:.|:     ..:.|...
Mouse   336 PGYKGPSCQERLCPEGLHGPGCTLPC---PCDTENTISCHPVTGACTCQPGW-----SGHYCNES 392

  Fly   386 CPQG-----------CQNGY-C-SAPNFCICRPGFI 408
            ||.|           ||||. | |....|.|.|||:
Mouse   393 CPAGYYGNGCQLPCTCQNGADCHSITGSCTCAPGFM 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB2NP_723857.1 None
Megf11XP_006511049.1 EMI 25..92 CDD:400092 3/4 (75%)
EGF_CA 188..233 CDD:419698 19/50 (38%)
EGF_CA 274..319 CDD:419698 12/46 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.