DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB2 and MEGF6

DIOPT Version :9

Sequence 1:NP_723857.1 Gene:NimB2 / 260645 FlyBaseID:FBgn0028543 Length:421 Species:Drosophila melanogaster
Sequence 2:XP_011539187.1 Gene:MEGF6 / 1953 HGNCID:3232 Length:1603 Species:Homo sapiens


Alignment Length:430 Identity:118/430 - (27%)
Similarity:152/430 - (35%) Gaps:146/430 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 WRSYNQSSYGWSTQNQSNYAWNQQNHVEQGSAGFVRAEVFQPVTLPPLYGHYVQPVTPPAHRV-- 113
            |:    :..||.       ||         ..|..|..|:        |..|.|..|..|..|  
Human   135 WK----AGCGWQ-------AW---------CVGHERRTVY--------YMGYRQVYTTEARTVLR 171

  Fly   114 ------QVLDETALFINKTRSAMASGVCYKEVPTASLLRNSRDQFVGNGTTPDMSRIQVCCDGYE 172
                  |..||..              |.....:|||.      |.|....|..::...|..|::
Human   172 CCRGWMQQPDEEG--------------CLSAECSASLC------FHGGRCVPGSAQPCHCPPGFQ 216

  Fly   173 RNPHIYRRCEPICADDCR--NGIC-----TAPNT--CVCIPG-HVRTAEGKC--ISTCPLGCGNG 225
             .|    ||: ...|:||  ||.|     ..|.:  |.|.|| .:.|....|  |::|.|  |||
Human   217 -GP----RCQ-YDVDECRTHNGGCQHRCVNTPGSYLCECKPGFRLHTDSRTCLAINSCAL--GNG 273

  Fly   226 VCDE--------RNECKCREGYSLEPETRKYC---------QPECKPGCSFGRCVAPNKCACLDG 273
            .|..        |:.|:||.|:.|: |..::|         ...|...|...|.:|  :|.|..|
Human   274 GCQHHCVQLTITRHRCQCRPGFQLQ-EDGRHCVRRSPCANRNGSCMHRCQVVRGLA--RCECHVG 335

  Fly   274 YRLAADG-SCEPVCD------SCENGKCTAPG--HCNCNAGY-LKLQGR-C-----EPICSIPCK 322
            |:||||| :||.|.:      .|.:|.....|  .|.|:||| |...|| |     |.:.|....
Human   336 YQLAADGKACEDVDECAAGLAQCAHGCLNTQGSFKCVCHAGYELGADGRQCYRIEMEIVNSCEAN 400

  Fly   323 NGRC--------IGPDICECASGFEWDRKSAECL--PKC-DLPCLNGVCV---GNNQCDCKTGYV 373
            ||.|        .|| :|.|..|:|.|.....|:  ..| |.||...||.   |..:|.|..||.
Human   401 NGGCSHGCSHTSAGP-LCTCPRGYELDTDQRTCIDVDDCADSPCCQQVCTNNPGGYECGCYAGYR 464

  Fly   374 R----------DE--HQRNICQPHCPQ-------GCQNGY 394
            .          ||  ..|..|:.||..       .|:.||
Human   465 LSADGCGCEDVDECASSRGGCEHHCTNLAGSFQCSCEAGY 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB2NP_723857.1 None
MEGF6XP_011539187.1 EMI 108..176 CDD:284877 14/68 (21%)
vWFA <215..261 CDD:294047 15/51 (29%)
FXa_inhibition 268..304 CDD:291342 13/38 (34%)
vWFA <342..384 CDD:294047 13/41 (32%)
FXa_inhibition 397..432 CDD:291342 10/35 (29%)
vWFA <432..469 CDD:294047 12/36 (33%)
vWFA <472..511 CDD:294047 9/33 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.