DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB2 and C25E10.10

DIOPT Version :9

Sequence 1:NP_723857.1 Gene:NimB2 / 260645 FlyBaseID:FBgn0028543 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_505347.1 Gene:C25E10.10 / 182894 WormBaseID:WBGene00016099 Length:169 Species:Caenorhabditis elegans


Alignment Length:202 Identity:50/202 - (24%)
Similarity:70/202 - (34%) Gaps:61/202 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 SLLRNSRDQFVGNGTTPDMSRIQVCCDGYERNPHIYRRCE-PICADDC-RNGICTAPNTCVCIPG 205
            :||..:|...:.|.....:|.....| |..:.|..| ||| |:...:| ....|:....||.||.
 Worm    10 ALLAFARSGVLKNTENMPISHTDALC-GSIKCPDNY-RCELPVSDLECGSEDDCSVDPKCVPIPI 72

  Fly   206 HVRTAEG-----KCISTCPLGCG--NGVCD---ERNECKCREGYSLEPETRKYCQPECKPGCSFG 260
            .....||     .|.|.|...|.  |..||   ..|.|:|::|...:..|              |
 Worm    73 RKPECEGDEELKACGSACEPTCDNENPECDLVCMTNVCQCKKGLVRDSAT--------------G 123

  Fly   261 RCVAPNKCACLDGYRLAADGSCEPVCDSCENGKCTAPGHCNCNAGYLKLQGRCEPICSIPCKNGR 325
            :||..|||:                       |||.  .|:.|.       :|| :..:.|:...
 Worm   124 KCVEKNKCS-----------------------KCTL--ECSENE-------KCE-LVELTCEEKP 155

  Fly   326 CIGPDIC 332
            |...|:|
 Worm   156 CQIVDVC 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB2NP_723857.1 None
C25E10.10NP_505347.1 TIL 77..131 CDD:366828 18/67 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.