DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB2 and M03F4.6

DIOPT Version :9

Sequence 1:NP_723857.1 Gene:NimB2 / 260645 FlyBaseID:FBgn0028543 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_508843.1 Gene:M03F4.6 / 180768 WormBaseID:WBGene00019759 Length:413 Species:Caenorhabditis elegans


Alignment Length:440 Identity:93/440 - (21%)
Similarity:130/440 - (29%) Gaps:207/440 - (47%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 VQVLDETALFINKTRSAMASGV----------------CYKEVPTASLLRNSRDQFVGNGTTPDM 161
            :|||   .||:...|.|:|..|                ||   ...|:.||||.....|....|:
 Worm     6 IQVL---FLFLIIDRLALAFDVPCAQKLIGSDCLFDEECY---GMNSVCRNSRCTCPTNFEEYDI 64

  Fly   162 -SRIQVCCDGYERNPHIYRRCEPI-----CADDCRNGICTAPNTCVCIPGHVRTAEGKCISTCPL 220
             .|..:|            |..|.     |..||:..:......|.|..|.:  .:|||:..||:
 Worm    65 DERTTIC------------RLAPAKIGDSCQRDCKPPLLCRDGKCECWGGSI--VDGKCVVLCPV 115

  Fly   221 GCGNGVCDERNECKCREGYSLEPETRKYCQPECKPGCSFGRCVAPNKCACLDGYRLAADGS---- 281
            |              ::.|.:|.....:.|..|:..   .:||.|.. ||:.|..|.|.|:    
 Worm   116 G--------------QQLYGVECTRVAHYQQPCEKD---SQCVDPFN-ACIAGTCLCAPGTTRDT 162

  Fly   282 ----CEPVC---------------------------DSCENG-KCT---AP--GHC--------- 300
                |...|                           |||..| :|.   :|  |||         
 Worm   163 ERGFCHATCPDGMHPRQTCRRLFINDIDMLENAANTDSCPLGYRCVTYGSPYVGHCCRLRCPYGE 227

  Fly   301 -----NCNAGYLKLQGRCEPI-----------------CSIPCK-------NGRCIG------P- 329
                 :|:|| .....:|.|:                 |..||:       ||:|:.      | 
 Worm   228 PDLSQSCDAG-ASPDSKCRPLTHFCFTVSEPGWKSSLCCPRPCRDPTPLYVNGQCLSIAHRGDPC 291

  Fly   330 ----------------DICECASGFEW--DRKSAECLPKCDLP-------CLNGV-----CVGNN 364
                            ..|:|..|:..  |.:...|...|.|.       ||..|     |..|.
 Worm   292 QIDQQCEGGITMSCTLGSCQCKLGYHENNDERFLTCTKDCTLEEVASNDRCLAKVQLGARCYSNK 356

  Fly   365 QC----DCKTGYVRDEHQRNICQPHCPQGCQNGY-----------CSAPN 399
            ||    :|:.|         .||      |:.||           |:.|:
 Worm   357 QCIQSAECRFG---------TCQ------CRCGYKQVKDQLLGVRCTNPD 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB2NP_723857.1 None
M03F4.6NP_508843.1 EB 113..160 CDD:279949 16/64 (25%)
EB 272..321 CDD:279949 7/48 (15%)
EB 331..381 CDD:279949 16/64 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.