DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB2 and R08E3.1

DIOPT Version :9

Sequence 1:NP_723857.1 Gene:NimB2 / 260645 FlyBaseID:FBgn0028543 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_001338800.1 Gene:R08E3.1 / 180758 WormBaseID:WBGene00019957 Length:1943 Species:Caenorhabditis elegans


Alignment Length:246 Identity:59/246 - (23%)
Similarity:81/246 - (32%) Gaps:84/246 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 LAGNSSESGWRS-----YNQSSYGWSTQN--------QSNYAWNQQNHVEQGSAGFVRAEVFQPV 93
            :..|:..:|:.:     |.::|||::..|        .|...:||||.:...||.|.:.....|.
 Worm  1267 IVNNNGTTGYYAIEVIGYLKTSYGFNIDNANGSNENLNSGVVYNQQNTLNIYSAPFSQLPKTDPS 1331

  Fly    94 TLPPL-YGHY-----VQPVTPPAHRVQVLDETALFINKTRSAMAS---------GVC-------Y 136
            ..|.| .|..     |.|.|           |.||   ||.:.||         .||       |
 Worm  1332 NFPYLTLGEIASNGTVLPAT-----------TVLF---TRKSGASCFYSHFTVLDVCSQSTTIGY 1382

  Fly   137 KEVPT--ASLLRNSRDQFVGNGTTPDMSRIQVCCDGYERNPHIYRRCEPICADDCR---NGI-CT 195
            :...|  .|.|.|...|||........:.....|.|:.         .|:....|.   .|| ||
 Worm  1383 QAQLTTRTSTLTNRIQQFVLTCFKTSYANNDTSCHGHG---------SPMATCACNADFGGIDCT 1438

  Fly   196 APNTCVCIPGHVRTAEGKCISTCPL---GCGNGVCDERNECKCREGYSLEP 243
            .|   .|:.|.||...   :..||:   |           .:|.|.:..||
 Worm  1439 EP---ACVNGGVRDGS---VCRCPVRFYG-----------LRCEESFESEP 1472



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166861
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.