Sequence 1: | NP_723857.1 | Gene: | NimB2 / 260645 | FlyBaseID: | FBgn0028543 | Length: | 421 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_034181.2 | Gene: | Dkk1 / 13380 | MGIID: | 1329040 | Length: | 272 | Species: | Mus musculus |
Alignment Length: | 209 | Identity: | 43/209 - (20%) |
---|---|---|---|
Similarity: | 66/209 - (31%) | Gaps: | 82/209 - (39%) |
- Green bases have known domain annotations that are detailed below.
Fly 254 KPGCSFGRCVAP-------NKCACLDGYR---LAADGSCEPVCDSCENGKCTAPGHCNCNAGYLK 308
Fly 309 LQGRCEPICSIPC--KNGRCIGPDICECASGFEWDRKSAECLPKCDLPCLNGVCVGNNQCDCKTG 371
Fly 372 YVRDEHQRNICQPH----------------------------C--PQGCQNGYCSAPNFC--ICR 404
Fly 405 PGFIKSGIKGRQTC 418 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
NimB2 | NP_723857.1 | None | |||
Dkk1 | NP_034181.2 | Dickkopf_N | 86..142 | CDD:282549 | 16/86 (19%) |
DKK-type Cys-1 | 86..141 | 16/85 (19%) | |||
DKK-type Cys-2 | 195..269 | 13/37 (35%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1218 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |