DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB2 and Dkk1

DIOPT Version :9

Sequence 1:NP_723857.1 Gene:NimB2 / 260645 FlyBaseID:FBgn0028543 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_034181.2 Gene:Dkk1 / 13380 MGIID:1329040 Length:272 Species:Mus musculus


Alignment Length:209 Identity:43/209 - (20%)
Similarity:66/209 - (31%) Gaps:82/209 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   254 KPGCSFGRCVAP-------NKCACLDGYR---LAADGSCEPVCDSCENGKCTAPGHCNCNAGYLK 308
            :||.:..  |||       ||...||.|:   .|.|..|.      .:..|::|.......|.::
Mouse    56 QPGSAVS--VAPGVLYEGGNKYQTLDNYQPYPCAEDEECG------SDEYCSSPSRGAAGVGGVQ 112

  Fly   309 LQGRCEPICSIPC--KNGRCIGPDICECASGFEWDRKSAECLPKCDLPCLNGVCVGNNQCDCKTG 371
                   || :.|  :..||:...:| |...:                |.||:|:.::......|
Mouse   113 -------IC-LACRKRRKRCMRHAMC-CPGNY----------------CKNGICMPSDHSHFPRG 152

  Fly   372 YVRDEHQRNICQPH----------------------------C--PQGCQNGYCSAPNFC--ICR 404
            .:.:....|:...|                            |  ...|..|.|.|.:|.  ||:
Mouse   153 EIEESIIENLGNDHNAAAGDGYPRRTTLTSKIYHTKGQEGSVCLRSSDCAAGLCCARHFWSKICK 217

  Fly   405 PGFIKSGIKGRQTC 418
            | .:|.|    |.|
Mouse   218 P-VLKEG----QVC 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB2NP_723857.1 None
Dkk1NP_034181.2 Dickkopf_N 86..142 CDD:282549 16/86 (19%)
DKK-type Cys-1 86..141 16/85 (19%)
DKK-type Cys-2 195..269 13/37 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.