DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB2 and WIF1

DIOPT Version :9

Sequence 1:NP_723857.1 Gene:NimB2 / 260645 FlyBaseID:FBgn0028543 Length:421 Species:Drosophila melanogaster
Sequence 2:NP_009122.2 Gene:WIF1 / 11197 HGNCID:18081 Length:379 Species:Homo sapiens


Alignment Length:220 Identity:71/220 - (32%)
Similarity:93/220 - (42%) Gaps:55/220 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 VRTAEGKCI---------------STCPLGCGN-GVCDERNECKCREGYSLEPETRKYCQPECKP 255
            |..:||..|               :.||.||.| |.|:||..|:|.:|:......:..|.|.|..
Human   156 VMNSEGNTILQTPQNAIFFKTCQQAECPGGCRNGGFCNERRICECPDGFHGPHCEKALCTPRCMN 220

  Fly   256 GCSFGRCVAPNKCACLDG-YRLAAD-GSCEPVCDSCENGKCTAPGHCNCNAGYLKLQG-RCE-PI 316
            |   |.||.|..|.|..| |.:..| .:|...|  ...|.|..||.|.|..|   |:| :|| ..
Human   221 G---GLCVTPGFCICPPGFYGVNCDKANCSTTC--FNGGTCFYPGKCICPPG---LEGEQCEISK 277

  Fly   317 CSIPCKN-GRCIGPDICECASGFEWDRKSAECLPKCDLPC-LNGVCVGNNQCDCKTGYVRDEHQR 379
            |..||:| |:|||...|:|:.|::.|..|.   |.|:..| .:|.|...|:|.|:.|:    |.|
Human   278 CPQPCRNGGKCIGKSKCKCSKGYQGDLCSK---PVCEPGCGAHGTCHEPNKCQCQEGW----HGR 335

  Fly   380 NICQPHC-------------PQGCQ 391
                 ||             |.|.|
Human   336 -----HCNKRYEASLIHALRPAGAQ 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB2NP_723857.1 None
WIF1NP_009122.2 WIF 35..179 CDD:128745 4/22 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 354..379 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.