DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB2 and pear1

DIOPT Version :9

Sequence 1:NP_723857.1 Gene:NimB2 / 260645 FlyBaseID:FBgn0028543 Length:421 Species:Drosophila melanogaster
Sequence 2:XP_017952446.2 Gene:pear1 / 100489801 XenbaseID:XB-GENE-6045593 Length:1087 Species:Xenopus tropicalis


Alignment Length:346 Identity:99/346 - (28%)
Similarity:130/346 - (37%) Gaps:118/346 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 DMSRIQVCCDGYERNPHIYRRCEPICADDCRNGICTAPNTCVCIPG------------HVRTAEG 212
            |..|...||.||..:..|   |.|.|..:|.:|.|.||:.|.|.||            ||...  
 Frog    85 DYRRRYWCCKGYYESNDI---CVPRCTQECVHGRCIAPDQCQCEPGWRGKDCSSACEAHVWGP-- 144

  Fly   213 KCISTCPLGC-GNGVCDERN-ECKCREGYSLEPETRKYCQPECKP-----GCSFGRCVAPN---- 266
            ||.||||  | .||.||..: .|.|..|:. :|    :|:..|.|     |||.. |...|    
 Frog   145 KCNSTCP--CQNNGACDAASGTCICPPGFR-DP----FCEKPCDPGTYGGGCSLS-CQCKNGAEC 201

  Fly   267 -----KCACLDGYR-----------LAADGSCEPVCDSCENGKCT-APGHCNCNAGYLKLQGRCE 314
                 .|.|.:||.           ..|:.||...|.....|.|. :.|.|:|..|::      .
 Frog   202 DPENGACLCPEGYTGPYCEIRCKEVQPANFSCSDQCLCQSGGICNQSSGECSCPPGWM------G 260

  Fly   315 PICSIPCKNG----RCIGPDICECASGFEWDRKSAECL------------------------PKC 351
            .:|||||.:|    .|  ...|.|.:|.:.|.|:.:||                        .||
 Frog   261 SLCSIPCPDGYYGRNC--KQECLCHNGGQCDPKTGQCLCSEGYTGDHCREECPIGKYGKDCSEKC 323

  Fly   352 DLPCLNGV-CVG-NNQCDCKTGY---VRDEHQ------------RNICQPHCPQGC--QNGYCSA 397
            |  |:|.| |.. |..|.|:.|:   ..||..            |.:|.|...|.|  .:|.|: 
 Frog   324 D--CINAVRCYHINGGCLCEHGFKGEACDERMCPPGLYGMPCNLRCLCDPLHSQSCHPMSGECA- 385

  Fly   398 PNFCICRPGFIKSGIKGRQTC 418
                 |:||:  ||:...:||
 Frog   386 -----CKPGW--SGLYCNETC 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB2NP_723857.1 None
pear1XP_017952446.2 EMI 29..97 CDD:400092 5/11 (45%)
exchanger_TraA <147..>310 CDD:411343 49/178 (28%)
exchanger_TraA <416..729 CDD:411343
Laminin_EGF 546..586 CDD:395007
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.