DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB2 and Stab1

DIOPT Version :9

Sequence 1:NP_723857.1 Gene:NimB2 / 260645 FlyBaseID:FBgn0028543 Length:421 Species:Drosophila melanogaster
Sequence 2:XP_008769275.1 Gene:Stab1 / 100363145 RGDID:2324745 Length:2630 Species:Rattus norvegicus


Alignment Length:308 Identity:76/308 - (24%)
Similarity:105/308 - (34%) Gaps:118/308 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   202 CIPGHVRTAEGKCISTCPLGCGNGVCDERNECKCREGYSLEPETRKYC----------------- 249
            |:..|......||::          |..:  .:|.:|:.|:...||.|                 
  Rat  1320 CLHSHAEALREKCVN----------CTRK--FRCTQGFQLQDTPRKSCVYRSGLSFSRGCSYTCA 1372

  Fly   250 ----QPECKPG----------------CS-FGRC----VAPNKCACLDGYRLAADGSCE-----P 284
                .|:|.||                || .|:|    :...:|.|.:|:...|...||     |
  Rat  1373 KKIQVPDCCPGFFGTLCEPCPGGLGGVCSGHGQCQDRFLGNGECRCQEGFHGTACEMCELGRYGP 1437

  Fly   285 VCD---SCENGKC----TAPGHCNCNAGYLKLQG-RCEP-----ICSIPC-KNGRCI----GPDI 331
            .|.   .|::|.|    ...|.|.||.|:   || ||:.     .|...| .|..||    |..:
  Rat  1438 TCSGVCDCDHGLCQEGLRGNGSCICNVGW---QGLRCDQKITDRQCPKKCDPNANCIQDSAGIPV 1499

  Fly   332 CECASGFEWDRKSAECLPKCDLPCLNG------------VCVGNNQCDCKTGYVRDE---HQRNI 381
            |.||:|:..:  .:.| .:.| ||.:|            |..|...|.|..||..|.   .:.|.
  Rat  1500 CVCAAGYSGN--GSYC-SEVD-PCTSGHGGCSPYANCTKVAPGQRTCTCLDGYTGDGELCQEINS 1560

  Fly   382 CQPHCPQGCQNGYCSAPNFCI----------CRPGFIKSGIKGRQTCQ 419
            |..|      ||.|.....||          ||.|:...||   |:|:
  Rat  1561 CLVH------NGGCHVNAECIPTGPQQVSCNCREGYSGDGI---QSCK 1599

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB2NP_723857.1 None
Stab1XP_008769275.1 Fasciclin 391..494 CDD:295423
Fasciclin 523..647 CDD:280607
EGF_3 834..863 CDD:289699
EGF_3 918..949 CDD:289699
EGF_3 955..991 CDD:289699
Fasciclin <1100..1180 CDD:280607
Fasciclin 1224..1313 CDD:295423
EGF_3 1519..1555 CDD:289699 9/35 (26%)
EGF_3 1561..1595 CDD:289699 10/39 (26%)
EGF_3 1604..1641 CDD:289699
Fasciclin 1666..1770 CDD:280607
Fasciclin 1796..1926 CDD:280607
EGF_Lam 2037..2082 CDD:238012
EGF_3 2154..2189 CDD:289699
EGF_3 2195..2232 CDD:289699
Link_Domain 2267..2359 CDD:295393
FAS1 2426..2521 CDD:214719
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.