DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DECR2 and CG31546

DIOPT Version :9

Sequence 1:NP_065715.1 Gene:DECR2 / 26063 HGNCID:2754 Length:292 Species:Homo sapiens
Sequence 2:NP_730973.1 Gene:CG31546 / 40691 FlyBaseID:FBgn0051546 Length:264 Species:Drosophila melanogaster


Alignment Length:257 Identity:81/257 - (31%)
Similarity:122/257 - (47%) Gaps:16/257 - (6%)


- Green bases have known domain annotations that are detailed below.


Human    29 KVAFITGGGSGIGFRIAEIFMRHGCHTVIASRSLPRVLTAARKLAGATGRRCLPLSMDVRAPPAV 93
            ||..|||..||||...||:|.:.|....:..|. ...|....|.....|.....::.|:..||.:
  Fly    14 KVVLITGAASGIGAAAAEMFSKLGACLALVDRE-EEGLICVMKRCMKMGHEPYGIAGDLLKPPEI 77

Human    94 MAAVDQALKEF-GRIDILINCAAGNFLCPAGAL---SFNAFKTVMDIDTSGTFNVSRVLYEKFFR 154
            .....:..:.: |::|:|:|   |..:.|.|.|   ....|..||:.:....|.::::|..:..:
  Fly    78 ECIARKTTERYEGKLDVLVN---GAGIMPTGTLQSTELACFTHVMEANVRSGFYLTKLLLPQLLQ 139

Human   155 DHGGVIVNITATLGNRGQALQVHAGSAKAAVDAMTRHLAVEWGPQNIRVNSLAPGPISGTEGLRR 219
            ..|. |||:::..|.|.....|....:|||||..||.||::.|||.:|||::.||.|  ...|::
  Fly   140 CKGS-IVNVSSVCGLRAFPNLVAYNMSKAAVDQFTRSLALDLGPQGVRVNAVNPGVI--RTNLQK 201

Human   220 LGGPQAS-----LSTKVTASPLQRLGNKTEIAHSVLYLASPLASYVTGAVLVADGGAWLTFP 276
            .||....     |........|.|:|...|:|.::.:|||.|||:|||..|..|||..:..|
  Fly   202 AGGMDEQSYAEFLEHSKKTHALGRIGEPKEVAAAICFLASELASFVTGVTLPVDGGKQVMCP 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DECR2NP_065715.1 TER_DECR_SDR_a 26..273 CDD:187627 80/252 (32%)
Substrate binding 126..128 0/1 (0%)
Microbody targeting signal. /evidence=ECO:0000250 290..292
CG31546NP_730973.1 fabG 9..257 CDD:235975 78/249 (31%)
NADB_Rossmann 11..261 CDD:304358 80/253 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.