| Sequence 1: | NP_056379.1 | Gene: | LRRTM2 / 26045 | HGNCID: | 19409 | Length: | 516 | Species: | Homo sapiens |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001188805.1 | Gene: | CG18095 / 34823 | FlyBaseID: | FBgn0028872 | Length: | 564 | Species: | Drosophila melanogaster |
| Alignment Length: | 323 | Identity: | 92/323 - (28%) |
|---|---|---|---|
| Similarity: | 149/323 - (46%) | Gaps: | 39/323 - (12%) |
- Green bases have known domain annotations that are detailed below.
|
Human 66 LSLRHNHITELERDQFASFSQLTWLHLDHNQISTVKEDAFQGLYKLKELILSSNKIFYLPNTTFT 130
Human 131 QLINLQNLDLSFNQLSSLHPELFYGLRKLQTLHLRSNSLRTIPVRLFWDCRSLEFLDLSTNRLRS 195
Human 196 LARNGFAGLIKLRELHLEHNQLTKI--------------------------NFAHFLRLSSLHTL 234
Human 235 FLQWNKISNLTCGMEWTWGTLEKLDLTGNEIK-AIDLTVFETMPNLKILLMD--NNKLNSLDSKI 296
Human 297 LNSLRSLTTVGLSGNLWECSARICALASWLG---SFQGRWEHSILCHSPDHTQGEDILDAVHG 356 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| LRRTM2 | NP_056379.1 | LRR 1 | 63..83 | 8/16 (50%) | |
| LRR | <65..312 | CDD:227223 | 82/274 (30%) | ||
| leucine-rich repeat | 66..86 | CDD:275380 | 8/19 (42%) | ||
| LRR 2 | 86..107 | 6/20 (30%) | |||
| leucine-rich repeat | 87..110 | CDD:275380 | 8/22 (36%) | ||
| LRR 3 | 110..131 | 6/20 (30%) | |||
| leucine-rich repeat | 111..134 | CDD:275380 | 6/22 (27%) | ||
| LRR 4 | 134..155 | 8/20 (40%) | |||
| leucine-rich repeat | 135..158 | CDD:275380 | 10/22 (45%) | ||
| LRR 5 | 158..179 | 7/20 (35%) | |||
| leucine-rich repeat | 159..182 | CDD:275380 | 7/22 (32%) | ||
| LRR 6 | 182..203 | 7/20 (35%) | |||
| leucine-rich repeat | 183..206 | CDD:275380 | 9/22 (41%) | ||
| LRR 7 | 206..227 | 9/46 (20%) | |||
| leucine-rich repeat | 207..230 | CDD:275380 | 9/48 (19%) | ||
| LRR 8 | 230..251 | 6/20 (30%) | |||
| leucine-rich repeat | 231..254 | CDD:275380 | 6/22 (27%) | ||
| LRR 9 | 254..275 | 7/21 (33%) | |||
| leucine-rich repeat | 255..278 | CDD:275380 | 7/23 (30%) | ||
| LRR 10 | 278..299 | 8/22 (36%) | |||
| leucine-rich repeat | 279..300 | CDD:275380 | 7/22 (32%) | ||
| PCC | 284..>351 | CDD:188093 | 17/71 (24%) | ||
| Involved in DLG4-binding. /evidence=ECO:0000250 | 513..516 | ||||
| CG18095 | NP_001188805.1 | leucine-rich repeat | 41..64 | CDD:275380 | |
| LRR_8 | 64..123 | CDD:290566 | |||
| leucine-rich repeat | 65..88 | CDD:275380 | |||
| leucine-rich repeat | 89..112 | CDD:275380 | |||
| leucine-rich repeat | 113..136 | CDD:275380 | |||
| LRR_RI | 115..384 | CDD:238064 | 73/245 (30%) | ||
| LRR_8 | 135..195 | CDD:290566 | 21/54 (39%) | ||
| leucine-rich repeat | 137..160 | CDD:275380 | 8/19 (42%) | ||
| leucine-rich repeat | 161..184 | CDD:275380 | 8/22 (36%) | ||
| LRR_8 | 184..243 | CDD:290566 | 21/58 (36%) | ||
| leucine-rich repeat | 185..208 | CDD:275380 | 6/22 (27%) | ||
| leucine-rich repeat | 209..232 | CDD:275380 | 10/22 (45%) | ||
| LRR_8 | 232..289 | CDD:290566 | 18/56 (32%) | ||
| leucine-rich repeat | 233..256 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 257..280 | CDD:275380 | 9/22 (41%) | ||
| LRR_8 | 280..339 | CDD:290566 | 12/60 (20%) | ||
| leucine-rich repeat | 281..304 | CDD:275380 | 6/22 (27%) | ||
| leucine-rich repeat | 305..328 | CDD:275380 | 3/24 (13%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR45712 |
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 2.010 | |||||