DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tp63 and p53

DIOPT Version :9

Sequence 1:NP_694518.1 Gene:tp63 / 260407 ZFINID:ZDB-GENE-030819-1 Length:588 Species:Danio rerio
Sequence 2:NP_996267.1 Gene:p53 / 2768677 FlyBaseID:FBgn0039044 Length:495 Species:Drosophila melanogaster


Alignment Length:393 Identity:86/393 - (21%)
Similarity:135/393 - (34%) Gaps:132/393 - (33%)


- Green bases have known domain annotations that are detailed below.


Zfish     7 NAPSSYSEPQYTSLGLLNSMDQNGGSTSTS------------PYNNDHAQNNVTAPSPY------ 53
            |.|.|:.........|...:|...|..:|:            ..||....|.:.|.:.:      
  Fly    60 NLPQSFGNESNEYAHLATPVDPAYGGNNTNNMMQFTNNLEILANNNSDGNNKINACNKFVCHKGT 124

Zfish    54 -AQPSSTFEALSPSPAIPSNTDYAG------PHTF------------------------DVSFQQ 87
             ::..||  .:.....||...:.:|      |..|                        |:..|.
  Fly   125 DSEDDST--EVDIKEDIPKTVEVSGSELTTEPMAFLQGLNSGNLMQFSQQSVLREMMLQDIQIQA 187

Zfish    88 SSTAK-------------------SATWTYSTELKKLYCQIAKTCPIQIKVLTNPP-QGAVIRAM 132
            ::..|                   .:.|.||..|.|||.::.|...:.::..:..| |...:|..
  Fly   188 NTLPKLENHNIGGYCFSMVLDEPPKSLWMYSIPLNKLYIRMNKAFNVDVQFKSKMPIQPLNLRVF 252

Zfish   133 PVYKKAEHVTEVVKRCPNHELSRE---FNDGQIAPPSHLIRVE-------GNSHAQYVEDSITGR 187
            ..:  :..|:..|.||.|| ||.|   .|:.::.  ..|:|.|       ||:..:    .|:.|
  Fly   253 LCF--SNDVSAPVVRCQNH-LSVEPLTANNAKMR--ESLLRSENPNSVYCGNAQGK----GISER 308

Zfish   188 QSVLVPY----EPPQVGTEFTTILYNFMCNSSCVGGMNRRPILIIVTLETRDGQVLGRRCFEARI 248
            .||:||.    ...:.|....|:.:.|:|.:||:|   |:...::..||...|.::|:.....:|
  Fly   309 FSVVVPLNMSRSVTRSGLTRQTLAFKFVCQNSCIG---RKETSLVFCLEKACGDIVGQHVIHVKI 370

Zfish   249 CACPGRDRKADEDSIRKQHVTDGTKSSEAFRQASSHLSQLNSIKKRRSTDEEV---------FCL 304
            |.||.|||..||                         .|||| |||:|..|..         .|:
  Fly   371 CTCPKRDRIQDE-------------------------RQLNS-KKRKSVPEAAEEDEPSKVRRCI 409

Zfish   305 PIK 307
            .||
  Fly   410 AIK 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tp63NP_694518.1 P53 67..262 CDD:279242 61/258 (24%)
P53_tetramer 292..332 CDD:285011 8/25 (32%)
SAM_tumor-p63 449..513 CDD:188971
SAM 453..513 CDD:197735
p53NP_996267.1 P53 203..383 CDD:176262 53/216 (25%)
P53_C 429..495 CDD:288471
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170580495
Domainoid 1 1.000 66 1.000 Domainoid score I9916
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002925
OrthoInspector 1 1.000 - - otm25509
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11447
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5172
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
98.930

Return to query results.
Submit another query.