DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RNF167 and DMA1

DIOPT Version :9

Sequence 1:NP_001357232.1 Gene:RNF167 / 26001 HGNCID:24544 Length:374 Species:Homo sapiens
Sequence 2:NP_011983.1 Gene:DMA1 / 856515 SGDID:S000001157 Length:416 Species:Saccharomyces cerevisiae


Alignment Length:151 Identity:38/151 - (25%)
Similarity:62/151 - (41%) Gaps:39/151 - (25%)


- Green bases have known domain annotations that are detailed below.


Human   189 GAVMIARCIQHR------KRLQRNRLTKEQLKQIPTHDYQKALNSSMFCPDLILPTCLISSTGFV 247
            |...|.||::.:      .:|:.|...||.|.:|  .:.||.                  :||. 
Yeast   279 GTEEIYRCVKMKIELNKSWKLKANAFNKEALSRI--KNLQKL------------------TTGL- 322

Human   248 GDQYDVCAICLDEYEDGDKLRVLPCAHAYHSRCVDPW--LTQTRKTCPICKQPVHRGPGDEDQEE 310
             :|.| |:|||::.:....:.:.||||::|..||...  :...:..||.|:.       :.|.|.
Yeast   323 -EQED-CSICLNKIKPCQAIFISPCAHSWHFHCVRRLVIMNYPQFMCPNCRT-------NCDLET 378

Human   311 ETQGQEEGD-EGEPRDHPASE 330
            ..:.:.|.: |.|..|.|..|
Yeast   379 TLESESESEFENEDEDEPDIE 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RNF167NP_001357232.1 PA_C_RZF_like 20..170 CDD:239038
RING-H2_RNF167 252..297 CDD:319711 15/46 (33%)
RING-H2 finger (C3H2C3-type) 254..295 CDD:319711 13/42 (31%)
DMA1NP_011983.1 FHA 121..308 CDD:224630 7/28 (25%)
RING-H2_Dmap_like 325..371 CDD:319372 14/46 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X670
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.