DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RNF167 and HRD1

DIOPT Version :9

Sequence 1:NP_001357232.1 Gene:RNF167 / 26001 HGNCID:24544 Length:374 Species:Homo sapiens
Sequence 2:NP_014630.1 Gene:HRD1 / 854149 SGDID:S000005373 Length:551 Species:Saccharomyces cerevisiae


Alignment Length:246 Identity:51/246 - (20%)
Similarity:86/246 - (34%) Gaps:64/246 - (26%)


- Green bases have known domain annotations that are detailed below.


Human   142 ERSSEYLRALFVYEKGARV------------LLVPDNTFPLGYYLIPFTGIVGLLVLAMGAVMIA 194
            :|....|...|:|||...|            :|:|   |.:...|:... :..:|.|......:.
Yeast   258 DRQFTGLEGKFMYEKAIDVFTRFLKTALHLSMLIP---FRMPMMLLKDV-VWDILALYQSGTSLW 318

Human   195 RCIQHRKRLQRN--RLTKEQLKQIPTHDYQKALNSSMFCPDLILPTCLISSTGFVGDQYDVCAIC 257
            :..::.|:|...  .:|.|||:.....|                               ::|.||
Yeast   319 KIWRNNKQLDDTLVTVTVEQLQNSANDD-------------------------------NICIIC 352

Human   258 LDEY----------EDGDKLRVLPCAHAYHSRCVDPWLTQTRKTCPICKQPVHRGPGDEDQEEET 312
            :||.          ....|.:.|||.|..|..|:..|:.:: :|||||:.||....|:..|...|
Yeast   353 MDELIHSPNQQTWKNKNKKPKRLPCGHILHLSCLKNWMERS-QTCPICRLPVFDEKGNVVQTTFT 416

Human   313 QGQEEGDEGEPRDHP--ASERTPLLGSSPTLPTSFGSLAPAPLVFPGPSTD 361
            ...:...:....|..  |:::.........|||.  :.:|...:.|..:.|
Yeast   417 SNSDITTQTTVTDSTGIATDQQGFANEVDLLPTR--TTSPDIRIVPTQNID 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RNF167NP_001357232.1 PA_C_RZF_like 20..170 CDD:239038 10/39 (26%)
RING-H2_RNF167 252..297 CDD:319711 18/54 (33%)
RING-H2 finger (C3H2C3-type) 254..295 CDD:319711 16/50 (32%)
HRD1NP_014630.1 HRD1 5..551 CDD:227568 51/246 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.