powered by:
Protein Alignment RNF167 and HRT1
DIOPT Version :9
Sequence 1: | NP_001357232.1 |
Gene: | RNF167 / 26001 |
HGNCID: | 24544 |
Length: | 374 |
Species: | Homo sapiens |
Sequence 2: | NP_014508.1 |
Gene: | HRT1 / 853986 |
SGDID: | S000005493 |
Length: | 121 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 62 |
Identity: | 20/62 - (32%) |
Similarity: | 27/62 - (43%) |
Gaps: | 16/62 - (25%) |
- Green bases have known domain annotations that are detailed below.
Human 252 DVCAICLDE------------YEDGDKLRVLP---CAHAYHSRCVDPWLTQTRKTCPICKQP 298
|.||||.:. ..|.|...|.. |.||:|..|::.|: :||..||:..||
Yeast 53 DNCAICRNHIMEPCIECQPKAMTDTDNECVAAWGVCNHAFHLHCINKWI-KTRDACPLDNQP 113
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.