DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RNF167 and gzl

DIOPT Version :9

Sequence 1:NP_001357232.1 Gene:RNF167 / 26001 HGNCID:24544 Length:374 Species:Homo sapiens
Sequence 2:NP_001097695.1 Gene:gzl / 40791 FlyBaseID:FBgn0037442 Length:536 Species:Drosophila melanogaster


Alignment Length:332 Identity:110/332 - (33%)
Similarity:169/332 - (50%) Gaps:60/332 - (18%)


- Green bases have known domain annotations that are detailed below.


Human    37 DFADLPALFGATLSQEGLQGFLVEA-HPDNACSPIAPPPPAPVNGSV-FIALLRRFDCNFDLKVL 99
            :|.||||.||..|...||:.::|.| .|...|..:..||......|. |:||:.|.:|.|:.|:.
  Fly    41 EFNDLPAQFGPNLPSNGLKVYVVPARRPYYGCDSLDRPPHLKYPPSAKFVALVARGECVFERKIR 105

Human   100 NAQKAGYGAAVVHNVNSNELLNMVWNSEEIQQQIWIPSVFIGERSSEYLRALFVYEKGARVLLVP 164
            .||.|.|.|.:|:|...::|..|   |.|....|.|||||:|..:.:.|...|..|    |:|:.
  Fly   106 VAQNASYSAVIVYNNEGDDLEQM---SAENITGIRIPSVFVGHTTGKALATYFTTE----VVLII 163

Human   165 DNTFPLG---YYLIPFTGIVGLLVLAMGAVMIARCIQHRKRLQRNRLTKEQLKQIPTHDYQKALN 226
            ::..|..   ..::||:.::|:..:.|...||.:||:.::||:|:||.|..||::|...|.|  |
  Fly   164 NDELPFNINTQLILPFSILIGMCFIIMVIYMIYKCIREQRRLRRHRLPKSMLKKLPVLRYTK--N 226

Human   227 SSMFCPDLILPTCLISSTGFVGDQYDVCAICLDEYEDGDKLRVLPCAHAYHSRCVDPWLTQTRKT 291
            ::                   .::||.|.|||:::.:.||||||||:|.||:.|:|||||:.|:.
  Fly   227 NA-------------------NNKYDTCVICLEDFIEDDKLRVLPCSHPYHTHCIDPWLTENRRV 272

Human   292 CPICKQPV----------HRGPG-------DED-----QEEETQGQEEGDEGEPRDHPASERTPL 334
            |||||:.|          .|.|.       |:|     |::::.|::.|....     ||.....
  Fly   273 CPICKRKVFTKGEARASRSRQPSLDNVTDTDDDTTPLLQQQQSNGRQVGQVSS-----ASSAGGA 332

Human   335 LGSSPTL 341
            .|||.::
  Fly   333 AGSSSSV 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RNF167NP_001357232.1 PA_C_RZF_like 20..170 CDD:239038 47/134 (35%)
RING-H2_RNF167 252..297 CDD:319711 27/44 (61%)
RING-H2 finger (C3H2C3-type) 254..295 CDD:319711 24/40 (60%)
gzlNP_001097695.1 PA_C_RZF_like 14..171 CDD:239038 48/136 (35%)
zf-RING_2 233..277 CDD:290367 26/43 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 77 1.000 Domainoid score I8867
eggNOG 1 0.900 - - E1_KOG4628
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 210 1.000 Inparanoid score I3672
Isobase 1 0.950 - 0 Normalized mean entropy S4419
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1487241at2759
OrthoFinder 1 1.000 - - FOG0001489
OrthoInspector 1 1.000 - - otm41191
orthoMCL 1 0.900 - - OOG6_103040
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X670
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.680

Return to query results.
Submit another query.